Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT9VTZN5)

DOT Name	Protein PAXX (PAXX)
Synonyms	Paralog of XRCC4 and XLF; XRCC4-like small protein
Gene Name	PAXX
Related Disease	Glioma ( )
UniProt ID	PAXX_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	3WTD; 3WTF; 4WJA; 7ZWA; 7ZYG; 8ASC; 8BH3; 8BHV; 8BHY; 8EZA; 8EZB
Pfam ID	PF15384
Sequence	MDPLSPPLCTLPPGPEPPRFVCYCEGEESGEGDRGGFNLYVTDAAELWSTCFTPDSLAAL KARFGLSAAEDITPRFRAACEQQAVALTLQEDRASLTLSGGPSALAFDLSKVPGPEAAPR LRALTLGLAKRVWSLERRLAAAEETAVSPRKSPRPAGPQLFLPDPDPQRGGPGPGVRRRC PGESLINPGFKSKKPAGGVDFDET
Function	Non-essential DNA repair protein involved in DNA non-homologous end joining (NHEJ); participates in double-strand break (DSB) repair and V(D)J recombination. May act as a scaffold required for accumulation of the Ku heterodimer, composed of XRCC5/Ku80 and XRCC6/Ku70, at double-strand break sites and promote the assembly and/or stability of the NHEJ machinery. Involved in NHEJ by promoting the ligation of blunt-ended DNA ends. Together with NHEJ1/XLF, collaborates with DNA polymerase lambda (POLL) to promote joining of non-cohesive DNA ends. Constitutes a non-essential component of classical NHEJ: has a complementary but distinct function with NHEJ1/XLF in DNA repair. Able to restrict infection by herpesvirus 1 (HSV-1) via an unknown mechanism.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance		REF
Glioma	DIS5RPEH	Strong	Biomarker	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Protein PAXX (PAXX).	[2]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Protein PAXX (PAXX).	[4]
------------------------------------------------------------------------------------

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Protein PAXX (PAXX).	[3]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Protein PAXX (PAXX).	[5]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of Protein PAXX (PAXX).	[6]
------------------------------------------------------------------------------------

References

1	PAXX Participates in Base Excision Repair via Interacting with Pol and Contributes to TMZ Resistance in Glioma Cells.J Mol Neurosci. 2018 Oct;66(2):214-221. doi: 10.1007/s12031-018-1157-4. Epub 2018 Sep 20.
2	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
3	Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
4	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
5	Isobaric tags for relative and absolute quantitation-based proteomics analysis of the effect of ginger oil on bisphenol A-induced breast cancer cell proliferation. Oncol Lett. 2021 Feb;21(2):101. doi: 10.3892/ol.2020.12362. Epub 2020 Dec 8.
6	Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.