Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT9X9KTC)

• DOT Name: Cancer/testis antigen family 45 member A8 (CT45A2)
• Synonyms: Cancer/testis antigen 45A8
• Gene Name: CT45A2
• Related Disease:
  Acute biphenotypic leukaemia
  Acute leukaemia
  Advanced cancer
  Non-small-cell lung cancer
• UniProt ID: CT458_HUMAN
• Pfam ID: PF15300
• Sequence:
  MTDKTEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKEKKLMT
  GHAIPPSQLDSQIDDFTGFSKDRMMQKPGSNAPVGGNVTSSFSGDDLECRETAFSPKSQQ
  EINADIKRQLVKELRCVGQKYEKIFEMLEGVQGPTAVRKRFFESIIKEAARCMRRDFVKH
  LKKKLKRMI

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Acute biphenotypic leukaemia	DISWE1R7	Strong	Biomarker	[1]
Acute leukaemia	DISDQFDI	Strong	Biomarker	[1]
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[2]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[3]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Cancer/testis antigen family 45 member A8 (CT45A2).	[4]

References

• [1] A novel spliced fusion of MLL with CT45A2 in a pediatric biphenotypic acute leukemia.BMC Cancer. 2010 Sep 29;10:518. doi: 10.1186/1471-2407-10-518.
• [2] Cancer/testis antigen CT45: analysis of mRNA and protein expression in human cancer.Int J Cancer. 2009 Jun 15;124(12):2893-8. doi: 10.1002/ijc.24296.
• [3] Ursolic acid promotes apoptosis and mediates transcriptional suppression of CT45A2 gene expression in non-small-cell lung carcinoma harbouring EGFR T790M mutations.Br J Pharmacol. 2019 Dec;176(24):4609-4624. doi: 10.1111/bph.14793. Epub 2019 Dec 26.
• [4] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.