Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OTA32DDZ)
| DOT Name | Protein EOLA1 (EOLA1) | ||||
|---|---|---|---|---|---|
| Synonyms | Endothelial-overexpressed lipopolysaccharide-associated factor 1; Endothelium and lymphocyte associated ASCH domain 1 | ||||
| Gene Name | EOLA1 | ||||
| UniProt ID | |||||
| 3D Structure | |||||
| PDB ID | |||||
| Sequence |
MKFGCLSFRQPYAGFVLNGIKTVETRWRPLLSSQRNCTIAVHIAHRDWEGDAWRELLVER
LGMTPAQIQALLRKGEKFGRGVIAGLVDIGETLQCPEDLTPDEVVELENQAVLTNLKQKY LTVISNPRWLLEPIPRKGGKDVFQVDIPEHLIPLGHEV |
||||
| Function | May play a role in cell protection during the inflammatory response. In epithelial cells, negatively regulates IL6 production and apoptosis through the regulation of MT2A expression. | ||||
| Tissue Specificity |
Expressed primarily in heart, skeletal muscle, kidney, liver and placenta. Relatively high level of expression in spleen, colon and small intestine. Almost no expression in brain, thymus, lung and peripheral blood leukocytes. Expressed in epithelial cells (at protein level) .
|
||||
Molecular Interaction Atlas (MIA) of This DOT
| Molecular Interaction Atlas (MIA) | |||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
3 Drug(s) Affected the Gene/Protein Processing of This DOT
|
|||||||||||||||||||||||||||||||||||
|
1 Drug(s) Affected the Post-Translational Modifications of This DOT
|
|||||||||||||||||||||||||||||||||||
References
