Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTA76Y5T)

DOT Name Small leucine-rich protein 1 (SMLR1)
Gene Name SMLR1
UniProt ID
SMLR1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MLSKGRSPRRKQVQTQRKAALVLSVTPMVPVGSVWLAMSSVLSAFMRELPGWFLFFGVFL
PVTLLLLLLIAYFRIKLIEVNEELSQNCDRQHNPKDGSSLYQRMKWT

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
6 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Small leucine-rich protein 1 (SMLR1). [1]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Small leucine-rich protein 1 (SMLR1). [2]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Small leucine-rich protein 1 (SMLR1). [3]
Bisphenol A DM2ZLD7 Investigative Bisphenol A affects the expression of Small leucine-rich protein 1 (SMLR1). [4]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of Small leucine-rich protein 1 (SMLR1). [5]
Acetaldehyde DMJFKG4 Investigative Acetaldehyde decreases the expression of Small leucine-rich protein 1 (SMLR1). [6]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Drug(s)

References

1 Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
2 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
3 New insights into BaP-induced toxicity: role of major metabolites in transcriptomics and contribution to hepatocarcinogenesis. Arch Toxicol. 2016 Jun;90(6):1449-58.
4 Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.
5 Cellular reactions to long-term volatile organic compound (VOC) exposures. Sci Rep. 2016 Dec 1;6:37842. doi: 10.1038/srep37842.
6 Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.