Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTASKG2P)

• DOT Name: BarH-like 2 homeobox protein (BARHL2)
• Gene Name: BARHL2
• Related Disease:
  Alzheimer disease
  Non-small-cell lung cancer
• UniProt ID: BARH2_HUMAN
• Pfam ID: PF00046
• Sequence:
  MTMEGASGSSFGIDTILSSASSGSPGMMNGDFRPLGEARTADFRSQATPSPCSEIDTVGT
  APSSPISVTMEPPEPHLVADATQHHHHLHHSQQPPPPAAAPTQSLQPLPQQQQPLPPQQP
  PPPPPQQLGSAASAPRTSTSSFLIKDILGDSKPLAACAPYSTSVSSPHHTPKQESNAVHE
  SFRPKLEQEDSKTKLDKREDSQSDIKCHGTKEEGDREITSSRESPPVRAKKPRKARTAFS
  DHQLNQLERSFERQKYLSVQDRMDLAAALNLTDTQVKTWYQNRRTKWKRQTAVGLELLAE
  AGNYSALQRMFPSPYFYHPSLLGSMDSTTAAAAAAAMYSSMYRTPPAPHPQLQRPLVPRV
  LIHGLGPGGQPALNPLSSPIPGTPHPR
• Function: Potential regulator of neural basic helix-loop-helix genes.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Alzheimer disease	DISF8S70	Strong	Biomarker	[1]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[2]

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of BarH-like 2 homeobox protein (BARHL2).	[3]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of BarH-like 2 homeobox protein (BARHL2).	[4]

References

• [1] Functional enrichment analysis of three Alzheimer's disease genome-wide association studies identities DAB1 as a novel candidate liability/protective gene.Biochem Biophys Res Commun. 2015 Aug 7;463(4):490-5. doi: 10.1016/j.bbrc.2015.05.044. Epub 2015 May 29.
• [2] Downregulation of BarH-like homeobox 2 promotes cell proliferation, migration and aerobic glycolysis through Wnt/-catenin signaling, and predicts a poor prognosis in non-small cell lung carcinoma.Thorac Cancer. 2018 Mar;9(3):390-399. doi: 10.1111/1759-7714.12593. Epub 2018 Jan 17.
• [3] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [4] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.