Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTB5Y637)

DOT Name	Olfactory receptor 4A47 (OR4A47)
Synonyms	Olfactory receptor OR11-113
Gene Name	OR4A47
UniProt ID	O4A47_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF13853
Sequence	MEPRKNVTDFVLLGFTQNPKEQKVLFVMFLLFYILTMVGNLLIVVTVTVSETLGSPMYFF LAGLSFIDIIYSSSISPRLISGLFFGNNSISFQSCMAQLFIEHIFGGSEVFLLLVMAYDC YVAICKPLHYLVIMRQWVCVVLLVVSWVGGFLHSVFQLSIIYGLPFCGPNVIDHFFCDMY PLLKLVCTDTHAIGLLVVANGGLACTIVFLLLLISYGVILHSLKNLSQKGRQKALSTCSS HMTVVVFFFVPCIFMYARPARTFPIDKSVSVFYTVITPMLNPLIYTLRNSEMTSAMKKLW RRDLISSST
Function	Odorant receptor.
KEGG Pathway	Olfactory transduction (hsa04740 )
Reactome Pathway	Expression and translocation of olfactory receptors (R-HSA-9752946 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Rifampicin	DM5DSFZ	Approved	Rifampicin decreases the expression of Olfactory receptor 4A47 (OR4A47).	[1]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Olfactory receptor 4A47 (OR4A47).	[2]
------------------------------------------------------------------------------------

References

1	Integrated analysis of rifampicin-induced microRNA and gene expression changes in human hepatocytes. Drug Metab Pharmacokinet. 2014;29(4):333-40.
2	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.