Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTB743V6)

• DOT Name: Solute carrier family 13 member 1 (SLC13A1)
• Synonyms: Renal sodium/sulfate cotransporter; Na(+)/sulfate cotransporter; hNaSi-1
• Gene Name: SLC13A1
• UniProt ID: S13A1_HUMAN
• Pfam ID: PF00939
• Sequence:
  MKFFSYILVYRRFLFVVFTVLVLLPLPIVLHTKEAECAYTLFVVATFWLTEALPLSVTAL
  LPSLMLPMFGIMPSKKVASAYFKDFHLLLIGVICLATSIEKWNLHKRIALKMVMMVGVNP
  AWLTLGFMSSTAFLSMWLSNTSTAAMVMPIAEAVVQQIINAEAEVEATQMTYFNGSTNHG
  LEIDESVNGHEINERKEKTKPVPGYNNDTGKISSKVELEKNSGMRTKYRTKKGHVTRKLT
  CLCIAYSSTIGGLTTITGTSTNLIFAEYFNTRYPDCRCLNFGSWFTFSFPAALIILLLSW
  IWLQWLFLGFNFKEMFKCGKTKTVQQKACAEVIKQEYQKLGPIRYQEIVTLVLFIIMALL
  WFSRDPGFVPGWSALFSEYPGFATDSTVALLIGLLFFLIPAKTLTKTTPTGEIVAFDYSP
  LITWKEFQSFMPWDIAILVGGGFALADGCEESGLSKWIGNKLSPLGSLPAWLIILISSLM
  VTSLTEVASNPATITLFLPILSPLAEAIHVNPLYILIPSTLCTSFAFLLPVANPPNAIVF
  SYGHLKVIDMVKAGLGVNIVGVAVVMLGICTWIVPMFDLYTYPSWAPAMSNETMP
• Function: Sodium:sulfate symporter that mediates sulfate reabsorption in the kidney and small intestine. Can also mediate the transport of selenate and thiosulfate.
• Tissue Specificity: Highly expressed in kidney; not detectable in the other tissues tested.
• Reactome Pathway: Sodium-coupled sulphate, di- and tri-carboxylate transporters (R-HSA-433137)

Molecular Interaction Atlas (MIA) of This DOT

This DOT Affected the Regulation of Drug Effects of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Sulfate	DMW0ZBF	Investigative	Solute carrier family 13 member 1 (SLC13A1) increases the uptake of Sulfate.	[4]

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Solute carrier family 13 member 1 (SLC13A1).	[1]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the expression of Solute carrier family 13 member 1 (SLC13A1).	[3]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Solute carrier family 13 member 1 (SLC13A1).	[2]

References

• [1] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [2] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [3] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [4] Disruption of NaS1 sulfate transport function in mice leads to enhanced acetaminophen-induced hepatotoxicity. Hepatology. 2006 Jun;43(6):1241-7. doi: 10.1002/hep.21207.