Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTBCEEOI)

DOT Name	RING finger protein 224 (RNF224)
Gene Name	RNF224
UniProt ID	RN224_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF13445
Sequence	MQDAAAGGPPGLGGGGPPEERTDCIICCSAYDLSGHLPRRLYCGHTFCQACVRRLDTPAP EQRWIPCPQCRQSTPTPRGGVAMLDLDLAAFLAVKAEREPARLEPLPLTSLKGSAITRQP AGLCPALGPQPHFPQPRYCCWGCGSLCCPPLGSPEV

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of RING finger protein 224 (RNF224).	[1]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of RING finger protein 224 (RNF224).	[1]
------------------------------------------------------------------------------------

References

1	Comparative Analysis of Transcriptomic Changes including mRNA and microRNA Expression Induced by the Xenoestrogens Zearalenone and Bisphenol A in Human Ovarian Cells. Toxins (Basel). 2023 Feb 9;15(2):140. doi: 10.3390/toxins15020140.