Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTBHGWTF)

• DOT Name: Protein ABHD12B (ABHD12B)
• Synonyms: EC 3.-.-.-; Abhydrolase domain-containing protein 12B; Alpha/beta hydrolase domain-containing protein 12B
• Gene Name: ABHD12B
• UniProt ID: AB12B_HUMAN
• EC Number: 3.-.-.-
• Pfam ID: PF12146
• Sequence:
  MDAQDCQAAASPEPPGPPARSCVAAWWDMVDRNLRYFPHSCSMLGRKIAALYDSFTSKSL
  KEHVFLPLIDMLIYFNFFKAPFLVDLKKPELKIPHTVNFYLRVEPGVMLGIWHTVPSCRG
  EDAKGKDCCWYEAALRDGNPIIVYLHGSAEHRAASHRLKLVKVLSDGGFHVLSVDYRGFG
  DSTGKPTEEGLTTDAICVYEWTKARSGITPVCLWGHSLGTGVATNAAKVLEEKGCPVDAI
  VLEAPFTNMWVASINYPLLKIYRNIPGFLRTLMDALRKDKIIFPNDENVKFLSSPLLILH
  GEDDRTVPLEYGKKLYEIARNAYRNKERVKMVIFPPGFQHNLLCKSPTLLITVRDFLSKQ
  WS

Molecular Interaction Atlas (MIA) of This DOT

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Protein ABHD12B (ABHD12B).	[1]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Protein ABHD12B (ABHD12B).	[2]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil decreases the expression of Protein ABHD12B (ABHD12B).	[3]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Protein ABHD12B (ABHD12B).	[5]
cinnamaldehyde	DMZDUXG	Investigative	cinnamaldehyde increases the expression of Protein ABHD12B (ABHD12B).	[6]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Protein ABHD12B (ABHD12B).	[4]

References

• [1] Design principles of concentration-dependent transcriptome deviations in drug-exposed differentiating stem cells. Chem Res Toxicol. 2014 Mar 17;27(3):408-20.
• [2] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [3] Evaluation of developmental toxicity using undifferentiated human embryonic stem cells. J Appl Toxicol. 2015 Feb;35(2):205-18.
• [4] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [5] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [6] Comparative DNA microarray analysis of human monocyte derived dendritic cells and MUTZ-3 cells exposed to the moderate skin sensitizer cinnamaldehyde. Toxicol Appl Pharmacol. 2009 Sep 15;239(3):273-83.