Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTBUMTWL)

DOT Name	B melanoma antigen 3 (BAGE3)
Synonyms	Cancer/testis antigen 2.3; CT2.3
Gene Name	BAGE3
Related Disease	Carcinoma of esophagus ( ) Esophageal cancer ( ) Neoplasm of esophagus ( ) Oral cavity squamous cell carcinoma ( ) Systemic lupus erythematosus ( ) Lupus nephritis ( )
UniProt ID	BAGE3_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF08180
Sequence	MAAGVVFLALSAQLLQARLMKEESPVVSWRLEPEDGTALDVHFVSTLEPLSNAVKRNVPR CIIILVLQEPTPFRISVTSSCFVQNTLTKLLKDRRKMQTVQCATAQETS
Function	Unknown. Candidate gene encoding tumor antigens.
Tissue Specificity	Not expressed in normal tissues except in testis. Expressed in melanoma, bladder and lung carcinomas.

Molecular Interaction Atlas (MIA) of This DOT

6 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Carcinoma of esophagus	DISS6G4D	Strong	Genetic Variation	[1]
Esophageal cancer	DISGB2VN	Strong	Genetic Variation	[1]
Neoplasm of esophagus	DISOLKAQ	Strong	Genetic Variation	[1]
Oral cavity squamous cell carcinoma	DISQVJVA	Strong	Biomarker	[2]
Systemic lupus erythematosus	DISI1SZ7	Strong	Genetic Variation	[3]
Lupus nephritis	DISCVGPZ	Limited	Genetic Variation	[4]
------------------------------------------------------------------------------------


⏷ Show the Full List of 6 Disease(s)

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of B melanoma antigen 3 (BAGE3).	[5]
------------------------------------------------------------------------------------

References

1	Definitive chemoradiation or surgery in elderly patients with potentially curable esophageal cancer in the Netherlands: a nationwide population-based study on patterns of care and survival.Acta Oncol. 2018 Sep;57(9):1192-1200. doi: 10.1080/0284186X.2018.1450521. Epub 2018 Mar 12.
2	Reconstruction of oral cavity defect using versatile buccinator myomucosal flaps in the treatment of cT2-3, N0 oral cavity squamous cell carcinoma: Feasibility, morbidity, and functional/oncological outcomes.Oral Oncol. 2017 Dec;75:95-99. doi: 10.1016/j.oraloncology.2017.11.007. Epub 2017 Nov 9.
3	Association of angiotensin-converting enzyme polymorphisms with systemic lupus erythematosus and nephritis: analysis of 644 SLE families.Genes Immun. 2002 Oct;3 Suppl 1:S42-6. doi: 10.1038/sj.gene.6363907.
4	Renin-angiotensin system gene polymorphisms predict the progression to renal insufficiency among Asians with lupus nephritis.Genes Immun. 2005 May;6(3):217-24. doi: 10.1038/sj.gene.6364179.
5	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.