Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTBUQ88D)

DOT Name	Olfactory receptor 11L1 (OR11L1)
Gene Name	OR11L1
Related Disease	Post-traumatic stress disorder ( )
UniProt ID	O11L1_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF13853
Sequence	MEPQNTSTVTNFQLLGFQNLLEWQALLFVIFLLIYCLTIIGNVVIITVVSQGLRLHSPMY MFLQHLSFLEVWYTSTTVPLLLANLLSWGQAISFSACMAQLYFFVFLGATECFLLAFMAY DRYLAICSPLRYPFLMHRGLCARLVVVSWCTGVSTGFLPSLMISRLDFCGRNQINHFFCD LPPLMQLSCSRVYITEVTIFILSIAVLCICFFLTLGPYVFIVSSILRIPSTSGRRKTFST CGSHLAVVTLYYGTMISMYVCPSPHLLPEINKIISVFYTVVTPLLNPVIYSLRNKDFKEA VRKVMRRKCGILWSTSKRKFLY
Function	Odorant receptor.
KEGG Pathway	Olfactory transduction (hsa04740 )
Reactome Pathway	Expression and translocation of olfactory receptors (R-HSA-9752946 )

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance		REF
Post-traumatic stress disorder	DISHL1EY	Limited	Genetic Variation	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Olfactory receptor 11L1 (OR11L1).	[2]
------------------------------------------------------------------------------------

References

1	Genome-Wide Association Study of Post-Traumatic Stress Disorder in Two High-Risk Populations.Twin Res Hum Genet. 2017 Jun;20(3):197-207. doi: 10.1017/thg.2017.12. Epub 2017 Mar 6.
2	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.