Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTC9D6WB)

• DOT Name: Protein IL-40 (C17ORF99)
• Synonyms: Interleukin-40; IL-40
• Gene Name: C17ORF99
• Related Disease: B-cell neoplasm
• UniProt ID: IL40_HUMAN
• Pfam ID: PF17736
• Sequence:
  MGLPGLFCLAVLAASSFSKAREEEITPVVSIAYKVLEVFPKGRWVLITCCAPQPPPPITY
  SLCGTKNIKVAKKVVKTHEPASFNLNVTLKSSPDLLTYFCWASSTSGAHVDSARLQMHWE
  LWSKPVSELRANFTLQDRGAGPRVEMICQASSGSPPITNSLIGKDGQVHLQQRPCHRQPA
  NFSFLPSQTSDWFWCQAANNANVQHSALTVVPPGGDQKMEDWQGPLESPILALPLYRSTR
  RLSEEEFGGFRIGNGEVRGRKAAAM
• Function: Probable B cell-associated cytokine that plays a role in the regulation of humoral immune responses. Involved in lymphocyte B cell development and immunoglobulin/IgA production.
• Tissue Specificity: Expressed in fetal liver and bone marrow . Expressed in peripheral blood lymphocyte B cells .

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
B-cell neoplasm	DISVY326	Strong	Altered Expression	[1]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Protein IL-40 (C17ORF99).	[2]
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Protein IL-40 (C17ORF99).	[3]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Protein IL-40 (C17ORF99).	[4]

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Protein IL-40 (C17ORF99).	[5]

References

• [1] Identification of IL-40, a Novel B Cell-Associated Cytokine.J Immunol. 2017 Nov 1;199(9):3326-3335. doi: 10.4049/jimmunol.1700534. Epub 2017 Oct 4.
• [2] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [3] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [4] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [5] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.