Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OTCASGO0)
| DOT Name | Opticin (OPTC) | ||||
|---|---|---|---|---|---|
| Synonyms | Oculoglycan | ||||
| Gene Name | OPTC | ||||
| Related Disease | |||||
| UniProt ID | |||||
| 3D Structure | |||||
| Pfam ID | |||||
| Sequence |
MRLLAFLSLLALVLQETGTASLPRKERKRREEQMPREGDSFEVLPLRNDVLNPDNYGEVI
DLSNYEELTDYGDQLPEVKVTSLAPATSISPAKSTTAPGTPSSNPTMTRPTTAGLLLSSQ PNHGLPTCLVCVCLGSSVYCDDIDLEDIPPLPRRTAYLYARFNRISRIRAEDFKGLTKLK RIDLSNNLISSIDNDAFRLLHALQDLILPENQLEALPVLPSGIEFLDVRLNRLQSSGIQP AAFRAMEKLQFLYLSDNLLDSIPGPLPLSLRSVHLQNNLIETMQRDVFCDPEEHKHTRRQ LEDIRLDGNPINLSLFPSAYFCLPRLPIGRFT |
||||
| Function |
Inhibits angiogenesis in the vitreous humor of the eye, and therefore represses neovascularization. Binds collagen fibrils. May be involved in collagen fiber organization via regulation of other members of the small leucine-rich repeat proteoglycan superfamily.
|
||||
| Tissue Specificity |
Expressed in cartilage and synovial membranes (at protein level) . Expressed in the retina, iris, ligament, skin and fetal liver (at protein level) . Expressed in the retinal pigment epithelium (at protein level) . Expressed in synovial fibroblasts and subchondral bone osteoblasts .
|
||||
| Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DOT
|
9 Disease(s) Related to This DOT
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Molecular Interaction Atlas (MIA) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
1 Drug(s) Affected the Gene/Protein Processing of This DOT
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
2 Drug(s) Affected the Post-Translational Modifications of This DOT
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
