Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTCLQ6NZ)

• DOT Name: C2 calcium-dependent domain-containing protein 4B (C2CD4B)
• Synonyms: Nuclear-localized factor 2; Protein FAM148B
• Gene Name: C2CD4B
• Related Disease:
  Non-insulin dependent diabetes
  Type-1/2 diabetes
• UniProt ID: C2C4B_HUMAN
• Sequence:
  MRLLEKLCSSAAGSSAPKPAFAKVLTPNRIPEFCIPPRLPAPCTLESPIRAAAVPRRCAA
  ESDLWPRAADEDAGRTDWDPRSQAALSLPHLPRVRTTYGFCALLESPHTRRKESLLLGGP
  PAPRPRAHSCGGGGGPDAPLGTLCGPRGPGPATPAAPGGPRLPQDALAAGPRRCRLLRVP
  DGLLSRALRAGRSRRLARVRSVSSGNEDEERRAGSESPARAPSSSPLSSRAPLPERLEAK
  GTVALGRAGDALRLAAEYCPGTRRLRLRLLRAESLFGGAPGPRAVRCRLSLVLRPPGTAR
  WQCSAVVGRSRKASFDQDFCFDGLSEDEVRRLAVRVKARDEGRGRDRGRLLGQGELSLGA
  LLLL
• Function: May be involved in inflammatory process. May regulate cell architecture and adhesion.
• Tissue Specificity: Specifically expressed in endothelial cells.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Non-insulin dependent diabetes	DISK1O5Z	Strong	Genetic Variation	[1]
Type-1/2 diabetes	DISIUHAP	Strong	Genetic Variation	[2]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of C2 calcium-dependent domain-containing protein 4B (C2CD4B).	[3]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of C2 calcium-dependent domain-containing protein 4B (C2CD4B).	[4]

References

• [1] A Common Type 2 Diabetes Risk Variant Potentiates Activity of an Evolutionarily Conserved Islet Stretch Enhancer and Increases C2CD4A and C2CD4B Expression.Am J Hum Genet. 2018 Apr 5;102(4):620-635. doi: 10.1016/j.ajhg.2018.02.020.
• [2] Genetic variant SLC2A2 [corrected] Is associated with risk of cardiovascular disease ?assessing the individual and cumulative effect of 46 type 2 diabetes related genetic variants.PLoS One. 2012;7(11):e50418. doi: 10.1371/journal.pone.0050418. Epub 2012 Nov 21.
• [3] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [4] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.