Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTCQ01F6)

• DOT Name: Spermatogenesis associated 6-like protein (SPATA6L)
• Gene Name: SPATA6L
• Related Disease:
  Schizophrenia
  Acute myelogenous leukaemia
  Prostate carcinoma
• UniProt ID: SPA6L_HUMAN
• Pfam ID: PF14909
• Sequence:
  MPLEVVVELQIRAISCPGVFLPGKQDVYLGVYLMNQYLETNSFPSAFPIMIQESMRFEKV
  FESAVDPGAVVDLLEMWDELAYYEENTRDFLFPEPKLTPSHPRRCREVLMKTALGFPGIA
  PKIEFSTRTAIRECVFLHRNRFLEERHESRRPLSTSHEPIFPLNTIKMKLKENNLNRLPK
  GMQARAPSQYSTRHFFQDQPAQLNLGNNFKISGGSKPPFVVRHVDSAKPFGENISEHHLR
  RSRRKSKFSDFPFPTRRASSLDSLAANVKVIKEPDERIVLRSDSSSCLDSSQFGKSSSSK
  QGDADFHGKASFATYQHSTSPGPLDQPLLRERFHPGSQSTWKNIHERVCSLLTSHRAQLH
  QNKEDSTSEVNYIIERPSYPLKKYSLHEQRYF

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Schizophrenia	DISSRV2N	Strong	Genetic Variation	[1]
Acute myelogenous leukaemia	DISCSPTN	Limited	Genetic Variation	[2]
Prostate carcinoma	DISMJPLE	Limited	Genetic Variation	[3]

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Spermatogenesis associated 6-like protein (SPATA6L).	[4]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Spermatogenesis associated 6-like protein (SPATA6L).	[5]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Spermatogenesis associated 6-like protein (SPATA6L).	[6]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Spermatogenesis associated 6-like protein (SPATA6L).	[7]

References

• [1] Five novel loci associated with antipsychotic treatment response in patients with schizophrenia: a genome-wide association study.Lancet Psychiatry. 2018 Apr;5(4):327-338. doi: 10.1016/S2215-0366(18)30049-X. Epub 2018 Mar 1.
• [2] Genome-wide haplotype association study identify the FGFR2 gene as a risk gene for acute myeloid leukemia.Oncotarget. 2017 Jan 31;8(5):7891-7899. doi: 10.18632/oncotarget.13631.
• [3] Radiogenomics Consortium Genome-Wide Association Study Meta-Analysis of Late Toxicity After Prostate Cancer Radiotherapy.J Natl Cancer Inst. 2020 Feb 1;112(2):179-190. doi: 10.1093/jnci/djz075.
• [4] Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
• [5] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [6] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [7] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.