Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OTDLYU1I)
| DOT Name | Beta-defensin 127 (DEFB127) | ||||
|---|---|---|---|---|---|
| Synonyms | Beta-defensin 27; DEFB-27; Defensin, beta 127 | ||||
| Gene Name | DEFB127 | ||||
| Related Disease | |||||
| UniProt ID | |||||
| 3D Structure | |||||
| Pfam ID | |||||
| Sequence |
MGLFMIIAILLFQKPTVTEQLKKCWNNYVQGHCRKICRVNEVPEALCENGRYCCLNIKEL
EACKKITKPPRPKPATLALTLQDYVTIIENFPSLKTQST |
||||
| Function | Has antibacterial activity. | ||||
| Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DOT
|
1 Disease(s) Related to This DOT
|
||||||||||||||||||||||||||
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
1 Drug(s) Affected the Gene/Protein Processing of This DOT
|
||||||||||||||||||||||||||
References
