General Information of Drug Off-Target (DOT) (ID: OTDSATGA)

DOT Name Fibroblast growth factor 10 (FGF10)
Synonyms FGF-10; Keratinocyte growth factor 2
Gene Name FGF10
Related Disease
LADD syndrome 1 ( )
Lacrimoauriculodentodigital syndrome 3 ( )
Aplasia of lacrimal and salivary glands ( )
LADD syndrome ( )
UniProt ID
FGF10_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1NUN
Pfam ID
PF00167
Sequence
MWKWILTHCASAFPHLPGCCCCCFLLLFLVSSVPVTCQALGQDMVSPEATNSSSSSFSSP
SSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGV
VAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVAL
NGKGAPRRGQKTRRKNTSAHFLPMVVHS
Function Plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. Required for normal branching morphogenesis. May play a role in wound healing.
KEGG Pathway
MAPK sig.ling pathway (hsa04010 )
Ras sig.ling pathway (hsa04014 )
Rap1 sig.ling pathway (hsa04015 )
Calcium sig.ling pathway (hsa04020 )
PI3K-Akt sig.ling pathway (hsa04151 )
Regulation of actin cytoskeleton (hsa04810 )
Pathways in cancer (hsa05200 )
Chemical carcinogenesis - receptor activation (hsa05207 )
Melanoma (hsa05218 )
Breast cancer (hsa05224 )
Gastric cancer (hsa05226 )
Reactome Pathway
(FGFR2 )
PIP3 activates AKT signaling (R-HSA-1257604 )
FGFR1b ligand binding and activation (R-HSA-190370 )
FGFR2b ligand binding and activation (R-HSA-190377 )
Activated point mutants of FGFR2 (R-HSA-2033519 )
Regulation of gene expression in early pancreatic precursor cells (R-HSA-210747 )
Constitutive Signaling by Aberrant PI3K in Cancer (R-HSA-2219530 )
Phospholipase C-mediated cascade (R-HSA-5654219 )
Phospholipase C-mediated cascade (R-HSA-5654221 )
Downstream signaling of activated FGFR1 (R-HSA-5654687 )
SHC-mediated cascade (R-HSA-5654688 )
PI-3K cascade (R-HSA-5654689 )
FRS-mediated FGFR1 signaling (R-HSA-5654693 )
PI-3K cascade (R-HSA-5654695 )
SHC-mediated cascade (R-HSA-5654699 )
FRS-mediated FGFR2 signaling (R-HSA-5654700 )
Negative regulation of FGFR1 signaling (R-HSA-5654726 )
Negative regulation of FGFR2 signaling (R-HSA-5654727 )
Signaling by FGFR2 in disease (R-HSA-5655253 )
FGFRL1 modulation of FGFR1 signaling (R-HSA-5658623 )
RAF/MAP kinase cascade (R-HSA-5673001 )
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling (R-HSA-6811558 )
PI3K Cascade (R-HSA-109704 )

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
LADD syndrome 1 DISHGCOR Definitive Autosomal dominant [1]
Lacrimoauriculodentodigital syndrome 3 DISX1KHE Strong Autosomal dominant [2]
Aplasia of lacrimal and salivary glands DISHF35B Supportive Autosomal dominant [3]
LADD syndrome DISH8TQ5 Supportive Autosomal dominant [4]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
4 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin increases the expression of Fibroblast growth factor 10 (FGF10). [5]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide decreases the expression of Fibroblast growth factor 10 (FGF10). [7]
Triclosan DMZUR4N Approved Triclosan decreases the expression of Fibroblast growth factor 10 (FGF10). [8]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Fibroblast growth factor 10 (FGF10). [11]
------------------------------------------------------------------------------------
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of Fibroblast growth factor 10 (FGF10). [6]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Fibroblast growth factor 10 (FGF10). [10]
------------------------------------------------------------------------------------
2 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT
Drug Name Drug ID Highest Status Interaction REF
Chondroitin sulfate DM0N19Y Phase 4 Chondroitin sulfate affects the binding of Fibroblast growth factor 10 (FGF10). [9]
Phencyclidine DMQBEYX Investigative Phencyclidine increases the secretion of Fibroblast growth factor 10 (FGF10). [12]
------------------------------------------------------------------------------------

References

1 Mutations in different components of FGF signaling in LADD syndrome. Nat Genet. 2006 Apr;38(4):414-7. doi: 10.1038/ng1757. Epub 2006 Feb 26.
2 Mutations in the gene encoding fibroblast growth factor 10 are associated with aplasia of lacrimal and salivary glands. Nat Genet. 2005 Feb;37(2):125-7. doi: 10.1038/ng1507. Epub 2005 Jan 16.
3 FGF10 missense mutations in aplasia of lacrimal and salivary glands (ALSG). Eur J Hum Genet. 2007 Mar;15(3):379-82. doi: 10.1038/sj.ejhg.5201762. Epub 2007 Jan 10.
4 LADD syndrome is caused by FGF10 mutations. Clin Genet. 2006 Apr;69(4):349-54. doi: 10.1111/j.1399-0004.2006.00597.x.
5 Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
6 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
7 Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
8 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
9 Specific molecular interactions of oversulfated chondroitin sulfate E with various heparin-binding growth factors. Implications as a physiological binding partner in the brain and other tissues. J Biol Chem. 2002 Nov 15;277(46):43707-16. doi: 10.1074/jbc.M207105200. Epub 2002 Sep 6.
10 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
11 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
12 Effects of Agricultural Organic Dusts on Human Lung-Resident Mesenchymal Stem (Stromal) Cell Function. Toxicol Sci. 2018 Apr 1;162(2):635-644. doi: 10.1093/toxsci/kfx286.