Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTE361GV)

DOT Name	Beta-defensin 115 (DEFB115)
Synonyms	Beta-defensin 15; DEFB-15; Defensin, beta 115
Gene Name	DEFB115
UniProt ID	DB115_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF13841
Sequence	MLPDHFSPLSGDIKLSVLALVVLVVLAQTAPDGWIRRCYYGTGRCRKSCKEIERKKEKCG EKHICCVPKEKDKLSHIHDQKETSELYI
Function	Has antibacterial activity.
Reactome Pathway	Defensins (R-HSA-1461973 ) Beta defensins (R-HSA-1461957 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Beta-defensin 115 (DEFB115).	[1]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Beta-defensin 115 (DEFB115).	[2]
------------------------------------------------------------------------------------

References

1	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
2	Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.