Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTERB7Z4)

• DOT Name: Transmembrane protease serine 5 (TMPRSS5)
• Synonyms: EC 3.4.21.-; Spinesin
• Gene Name: TMPRSS5
• Related Disease:
  Bipolar disorder
  Schizoaffective disorder
  Schizophrenia
  Nonsyndromic genetic hearing loss
• UniProt ID: TMPS5_HUMAN
• EC Number: 3.4.21.-
• Pfam ID: PF15494 ; PF00089
• Sequence:
  MSLMLDDQPPMEAQYAEEGPGPGIFRAEPGDQQHPISQAVCWRSMRRGCAVLGALGLLAG
  AGVGSWLLVLYLCPAASQPISGTLQDEEITLSCSEASAEEALLPALPKTVSFRINSEDFL
  LEAQVRDQPRWLLVCHEGWSPALGLQICWSLGHLRLTHHKGVNLTDIKLNSSQEFAQLSP
  RLGGFLEEAWQPRNNCTSGQVVSLRCSECGARPLASRIVGGQSVAPGRWPWQASVALGFR
  HTCGGSVLAPRWVVTAAHCMHSFRLARLSSWRVHAGLVSHSAVRPHQGALVERIIPHPLY
  SAQNHDYDVALLRLQTALNFSDTVGAVCLPAKEQHFPKGSRCWVSGWGHTHPSHTYSSDM
  LQDTVVPLFSTQLCNSSCVYSGALTPRMLCAGYLDGRADACQGDSGGPLVCPDGDTWRLV
  GVVSWGRGCAEPNHPGVYAKVAEFLDWIHDTAQDSLL
• Function: May play a role in hearing.
• Tissue Specificity: Brain-specific. Predominantly expressed in neurons, in their axons, and at the synapses of motoneurons in the spinal cord.

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Bipolar disorder	DISAM7J2	moderate	Genetic Variation	[1]
Schizoaffective disorder	DISLBW6B	moderate	Genetic Variation	[1]
Schizophrenia	DISSRV2N	moderate	Genetic Variation	[1]
Nonsyndromic genetic hearing loss	DISZX61P	Limited	Autosomal dominant	[2]

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Transmembrane protease serine 5 (TMPRSS5).	[3]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Transmembrane protease serine 5 (TMPRSS5).	[4]

References

• [1] Genome-wide association studies of smooth pursuit and antisaccade eye movements in psychotic disorders: findings from the B-SNIP study.Transl Psychiatry. 2017 Oct 24;7(10):e1249. doi: 10.1038/tp.2017.210.
• [2] Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
• [3] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [4] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.