Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTEUEMKK)

DOT Name	Protein S100-G (S100G)
Synonyms	Calbindin-D9k; S100 calcium-binding protein G; Vitamin D-dependent calcium-binding protein, intestinal; CABP
Gene Name	S100G
UniProt ID	S100G_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF00036 ; PF01023
Sequence	MSTKKSPEELKRIFEKYAAKEGDPDQLSKDELKLLIQAEFPSLLKGPNTLDDLFQELDKN GDGEVSFEEFQVLVKKISQ
KEGG Pathway	Mineral absorption (hsa04978 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Protein S100-G (S100G).	[1]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Protein S100-G (S100G).	[2]
------------------------------------------------------------------------------------

References

1	Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
2	Effect of 17beta-oestradiol on transepithelial calcium transport in human intestinal-like Caco-2 cells and its interactions with 1,25-dihydroxycholecalciferol and 9-cis retinoic acid. Eur J Nutr. 2006 Jun;45(4):234-41. doi: 10.1007/s00394-006-0590-2. Epub 2006 Feb 20.