Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTEV3DD7)

• DOT Name: Galactoside-binding soluble lectin 13 (LGALS13)
• Synonyms: Galectin-13; Gal-13; Placental tissue protein 13; PP13; Placental protein 13
• Gene Name: LGALS13
• Related Disease:
  Advanced cancer
  Neoplasm
  B-cell lymphoma
  Cardiac failure
  Congestive heart failure
  Obesity
  Pre-eclampsia
  Turner syndrome
  Choriocarcinoma
  Fetal growth restriction
  Trichohepatoenteric syndrome
• UniProt ID: PP13_HUMAN
• PDB ID: 5XG7; 5XG8; 5Y03; 6A62; 6A63; 6A64; 6A65; 6A66; 6KJW; 6KJX; 6KJY
• Pfam ID: PF00337
• Sequence:
  MSSLPVPYKLPVSLSVGSCVIIKGTPIHSFINDPQLQVDFYTDMDEDSDIAFRFRVHFGN
  HVVMNRREFGIWMLEETTDYVPFEDGKQFELCIYVHYNEYEIKVNGIRIYGFVHRIPPSF
  VKMVQVSRDISLTSVCVCN
• Function: Binds beta-galactoside and lactose. Strong inducer of T-cell apoptosis. Has hemagglutinating activity towards chicken erythrocytes.
• Tissue Specificity: Detected in adult and fetal spleen, fetal kidney, adult urinary bladder and placenta. Placental expression originates predominantly from the syncytiotrophoblast.

Molecular Interaction Atlas (MIA) of This DOT

11 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Definitive	Biomarker	[1]
Neoplasm	DISZKGEW	Definitive	Biomarker	[1]
B-cell lymphoma	DISIH1YQ	Strong	Biomarker	[2]
Cardiac failure	DISDC067	Strong	Biomarker	[3]
Congestive heart failure	DIS32MEA	Strong	Biomarker	[3]
Obesity	DIS47Y1K	Strong	Altered Expression	[4]
Pre-eclampsia	DISY7Q29	Strong	Altered Expression	[5]
Turner syndrome	DIS2035C	Strong	Altered Expression	[6]
Choriocarcinoma	DISDBVNL	moderate	Altered Expression	[7]
Fetal growth restriction	DIS5WEJ5	moderate	Genetic Variation	[8]
Trichohepatoenteric syndrome	DISL3ODF	moderate	Altered Expression	[7]

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Forskolin	DM6ITNG	Investigative	Forskolin increases the expression of Galactoside-binding soluble lectin 13 (LGALS13).	[9]

References

• [1] Identification of pyrrolopyrimidine derivative PP-13 as a novel microtubule-destabilizing agent with promising anticancer properties.Sci Rep. 2017 Aug 31;7(1):10209. doi: 10.1038/s41598-017-09491-9.
• [2] Regulatory roles of altered N- and O-glycosylation of CD45 in galectin-1-induced cell death in human diffuse large B cell lymphoma.Int J Oncol. 2005 Apr;26(4):1063-8.
• [3] Assessment of Galectin-3 Polymorphism in Subjects with Chronic Chagas Disease.Arq Bras Cardiol. 2015 Nov;105(5):472-8. doi: 10.5935/abc.20150105. Epub 2015 Aug 25.
• [4] Personalized Therapy Against Preeclampsia by Replenishing Placental Protein 13 (PP13) Targeted to Patients With Impaired PP13 Molecule or Function.Comput Struct Biotechnol J. 2017 Sep 22;15:433-446. doi: 10.1016/j.csbj.2017.09.002. eCollection 2017.
• [5] Placental protein 13 (galectin-13) has decreased placental expression but increased shedding and maternal serum concentrations in patients presenting with preterm pre-eclampsia and HELLP syndrome.Virchows Arch. 2008 Oct;453(4):387-400. doi: 10.1007/s00428-008-0658-x. Epub 2008 Sep 13.
• [6] Maternal serum placental protein 13 at eleven to thirteen weeks in chromosomally abnormal pregnancies.Fetal Diagn Ther. 2010;27(2):72-7. doi: 10.1159/000294340. Epub 2010 Mar 23.
• [7] Effects of vitamins C and E, acetylsalicylic acid and heparin on fusion, beta-hCG and PP13 expression in BeWo cells.Placenta. 2010 May;31(5):431-8. doi: 10.1016/j.placenta.2010.02.017. Epub 2010 Mar 29.
• [8] New Predictive Model at 11(+0) to 13(+6) Gestational Weeks for Early-Onset Preeclampsia With Fetal Growth Restriction.Reprod Sci. 2017 May;24(5):783-789. doi: 10.1177/1933719116669053. Epub 2016 Sep 27.
• [9] Cadmium inhibits forskolin-induced differentiation of human placental BeWo cells. J Toxicol Sci. 2022;47(8):309-315. doi: 10.2131/jts.47.309.