Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTF8OJQC)

DOT Name	Insulin-like peptide INSL6 (INSL6)
Synonyms	Insulin-like peptide 6; Relaxin/insulin-like factor 1
Gene Name	INSL6
Related Disease	Cardiac failure ( ) Congestive heart failure ( ) Fibrosarcoma ( ) Cerebrotendinous xanthomatosis ( ) Polycystic ovarian syndrome ( ) Psoriatic arthritis ( )
UniProt ID	INSL6_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF00049
Sequence	MPRLLRLSLLWLGLLLVRFSRELSDISSARKLCGRYLVKEIEKLCGHANWSQFRFEEETP FSRLIAQASEKVEAYSPYQFESPQTASPARGRGTNPVSTSWEEAVNSWEMQSLPEYKDKK GYSPLGKTREFSSSHNINVYIHENAKFQKKRRNKIKTLSNLFWGHHPQRKRRGYSEKCCL TGCTKEELSIACLPYIDFKRLKEKRSSLVTKIY
Function	May have a role in sperm development and fertilization.
Tissue Specificity	Testis specific.

Molecular Interaction Atlas (MIA) of This DOT

6 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Cardiac failure	DISDC067	Strong	Biomarker	[1]
Congestive heart failure	DIS32MEA	Strong	Biomarker	[1]
Fibrosarcoma	DISWX7MU	Strong	Biomarker	[2]
Cerebrotendinous xanthomatosis	DIST9FNK	moderate	Biomarker	[3]
Polycystic ovarian syndrome	DISZ2BNG	moderate	Altered Expression	[4]
Psoriatic arthritis	DISLWTG2	Limited	Genetic Variation	[5]
------------------------------------------------------------------------------------


⏷ Show the Full List of 6 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Insulin-like peptide INSL6 (INSL6).	[6]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Insulin-like peptide INSL6 (INSL6).	[7]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Insulin-like peptide INSL6 (INSL6).	[8]
------------------------------------------------------------------------------------

References

1	Relaxin Family Member Insulin-Like Peptide 6 Ameliorates Cardiac Fibrosis and Prevents Cardiac Remodeling in Murine Heart Failure Models.J Am Heart Assoc. 2018 Jun 10;7(12):e008441. doi: 10.1161/JAHA.117.008441.
2	Mesenchymal stem cells as a gene therapy carrier for treatment of fibrosarcoma.Cytotherapy. 2009;11(5):516-26. doi: 10.1080/14653240902960429.
3	Insulin-like 6 is induced by muscle injury and functions as a regenerative factor.J Biol Chem. 2010 Nov 12;285(46):36060-9. doi: 10.1074/jbc.M110.160879. Epub 2010 Aug 31.
4	Circulating insulin-like peptide 5 levels and its association with metabolic and hormonal parameters in women with polycystic ovary syndrome.J Endocrinol Invest. 2019 Mar;42(3):303-312. doi: 10.1007/s40618-018-0917-x. Epub 2018 Jun 28.
5	Genome-wide Association Analysis of Psoriatic Arthritis and Cutaneous Psoriasis Reveals Differences in Their Genetic Architecture.Am J Hum Genet. 2015 Dec 3;97(6):816-36. doi: 10.1016/j.ajhg.2015.10.019. Epub 2015 Nov 28.
6	Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
7	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
8	DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.