Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTFFEP9A)

DOT Name	Spliceosome-associated protein CWC15 homolog (CWC15)
Gene Name	CWC15
Related Disease	Lymphogranuloma venereum ( ) Respiratory disease ( )
UniProt ID	CWC15_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	5MQF; 5XJC; 5YZG; 5Z56; 5Z57; 5Z58; 6FF4; 6FF7; 6ICZ; 6ID0; 6ID1; 6QDV; 6ZYM; 7AAV; 7ABF; 7ABG; 7ABI; 7DVQ; 7QTT; 7W59; 7W5A; 7W5B; 8C6J; 8CH6
Pfam ID	PF04889
Sequence	MTTAARPTFEPARGGRGKGEGDLSQLSKQYSSRDLPSHTKIKYRQTTQDAPEEVRNRDFR RELEERERAAAREKNRDRPTREHTTSSSVSKKPRLDQIPAANLDADDPLTDEEDEDFEEE SDDDDTAALLAELEKIKKERAEEQARKEQEQKAEEERIRMENILSGNPLLNLTGPSQPQA NFKVKRRWDDDVVFKNCAKGVDDQKKDKRFVNDTLRSEFHKKFMEKYIK
Function	Involved in pre-mRNA splicing as component of the spliceosome. Component of the PRP19-CDC5L complex that forms an integral part of the spliceosome and is required for activating pre-mRNA splicing. As a component of the minor spliceosome, involved in the splicing of U12-type introns in pre-mRNAs (Probable).
KEGG Pathway	Spliceosome (hsa03040 )
Reactome Pathway	mRNA Splicing - Major Pathway (R-HSA-72163 )

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Lymphogranuloma venereum	DIS0MMFT	Definitive	Altered Expression	[1]
Respiratory disease	DISGGAGJ	Strong	Genetic Variation	[2]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate affects the expression of Spliceosome-associated protein CWC15 homolog (CWC15).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Spliceosome-associated protein CWC15 homolog (CWC15).	[4]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Spliceosome-associated protein CWC15 homolog (CWC15).	[5]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Spliceosome-associated protein CWC15 homolog (CWC15).	[6]
------------------------------------------------------------------------------------

References

1	Assessment of the load and transcriptional dynamics of Chlamydia trachomatis plasmid according to strains' tissue tropism.Microbiol Res. 2013 Jul 19;168(6):333-339. doi: 10.1016/j.micres.2013.02.001. Epub 2013 Apr 13.
2	Porcine reproductive and respiratory disease virus: Evolution and recombination yields distinct ORF5 RFLP 1-7-4 viruses with individual pathogenicity.Virology. 2018 Jan 1;513:168-179. doi: 10.1016/j.virol.2017.10.002. Epub 2017 Nov 5.
3	Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
4	Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
5	Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
6	Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.