Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTFOA92Z)

• DOT Name: Putative adrenomedullin-5-like protein (ADM5)
• Gene Name: ADM5
• Related Disease: Advanced cancer
• UniProt ID: ADM5_HUMAN
• Sequence:
  MTIHILILLLLLAFSAQGDLDTAARRGQHQVPQHRGHVCYLGVCRTHRLAEIIYWIRCLH
  QGALGEGQPRAPGPLQLWAPPVARGGSPARFPGFRPAARGLAQCPARWVTSGTARPLLGF
  SLPICMLELLLHISSPLTPAPETVFPSPSPGCD
• Function: Probable non-functional remnant of adrenomedullin-5.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[1]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Putative adrenomedullin-5-like protein (ADM5).	[2]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Putative adrenomedullin-5-like protein (ADM5).	[7]

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Putative adrenomedullin-5-like protein (ADM5).	[3]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Putative adrenomedullin-5-like protein (ADM5).	[4]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Putative adrenomedullin-5-like protein (ADM5).	[5]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Putative adrenomedullin-5-like protein (ADM5).	[6]

References

• [1] Common and differentially expressed long noncoding RNAs for the characterization of high and low grade bladder cancer.Gene. 2016 Oct 30;592(1):78-85. doi: 10.1016/j.gene.2016.07.042. Epub 2016 Jul 20.
• [2] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [3] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [4] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [5] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [6] Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
• [7] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.