Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTG98AYZ)

• DOT Name: Tumor protein D55 (TPD52L3)
• Synonyms: hD55; Testis development protein NYD-SP25; Tumor protein D52-like 3
• Gene Name: TPD52L3
• UniProt ID: TPD55_HUMAN
• Pfam ID: PF04201
• Sequence:
  MPHARTETSVGTYESHSTSELEDLTEPEQRELKTKLTKLEAEIVTLRHVLAAKERRCGEL
  KRKLGLTALVGLRQNLSKSWLDVQVSNTYVKQKTSAALSTMGTLICRKLGGVKKSATFRS
  FEGLMGTIKSKVSGGKRAWP
• Tissue Specificity: Specifically expressed in testis. Expressed at 5.6-fold higher levels in adult testis than in fetal testis.

Molecular Interaction Atlas (MIA) of This DOT

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Tumor protein D55 (TPD52L3).	[1]
Malathion	DMXZ84M	Approved	Malathion decreases the expression of Tumor protein D55 (TPD52L3).	[2]
Fenfluramine	DM0762O	Phase 3	Fenfluramine increases the expression of Tumor protein D55 (TPD52L3).	[3]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Tumor protein D55 (TPD52L3).	[4]

References

• [1] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [2] Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
• [3] Fenfluramine-induced gene dysregulation in human pulmonary artery smooth muscle and endothelial cells. Pulm Circ. 2011 Jul-Sep;1(3):405-18. doi: 10.4103/2045-8932.87310.
• [4] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.