Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTH6YQDX)

DOT Name	Membrane-spanning 4-domains subfamily A member 5 (MS4A5)
Synonyms	CD20 antigen-like 2; Testis-expressed transmembrane protein 4
Gene Name	MS4A5
Related Disease	Prostate carcinoma ( )
UniProt ID	MS4A5_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF04103
Sequence	MDSSTAHSPVFLVFPPEITASEYESTELSATTFSTQSPLQKLFARKMKILGTIQILFGIM TFSFGVIFLFTLLKPYPRFPFIFLSGYPFWGSVLFINSGAFLIAVKRKTTETLIILSRIM NFLSALGAIAGIILLTFGFILDQNYICGYSHQNSQCKAVTVLFLGILITLMTFSIIELFI SLPFSILGCHSEDCDCEQCC
Function	May be involved in signal transduction as a component of a multimeric receptor complex.
Tissue Specificity	Expressed at high level in the testis. Detected also in the pancreas, heart and in the brain.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance		REF
Prostate carcinoma	DISMJPLE	Limited	Genetic Variation	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Membrane-spanning 4-domains subfamily A member 5 (MS4A5).	[2]
------------------------------------------------------------------------------------

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Membrane-spanning 4-domains subfamily A member 5 (MS4A5).	[3]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of Membrane-spanning 4-domains subfamily A member 5 (MS4A5).	[4]
------------------------------------------------------------------------------------

References

1	Meta-analysis of Genome Wide Association Studies Identifies Genetic Markers of Late Toxicity Following Radiotherapy for Prostate Cancer.EBioMedicine. 2016 Aug;10:150-63. doi: 10.1016/j.ebiom.2016.07.022. Epub 2016 Jul 20.
2	Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
3	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
4	DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.