Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTHVCMIP)

• DOT Name: Carcinoembryonic antigen-related cell adhesion molecule 21 (CEACAM21)
• Gene Name: CEACAM21
• Related Disease:
  Lung adenocarcinoma
  Schizophrenia
  Type-1 diabetes
• UniProt ID: CEA21_HUMAN
• Pfam ID: PF13927 ; PF07686
• Sequence:
  MGPPSACPHRECIPWQGLLLTASLLTFWNAPTTAWLFIASAPFEVAEGENVHLSVVYLPE
  NLYSYGWYKGKTVEPNQLIAAYVIDTHVRTPGPAYSGRETISPSGDLHFQNVTLEDTGYY
  NLQVTYRNSQIEQASHHLRVYESVAQPSIQASSTTVTEKGSVVLTCHTNNTGTSFQWIFN
  NQRLQVTKRMKLSWFNHVLTIDPIRQEDAGEYQCEVSNPVSSNRSDPLKLTVKSDDNTLG
  ILIGVLVGSLLVAALVCFLLLRKTGRASDQSDFREQQPPASTPGHGPSDSSIS

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Lung adenocarcinoma	DISD51WR	Strong	Biomarker	[1]
Schizophrenia	DISSRV2N	Strong	Biomarker	[2]
Type-1 diabetes	DIS7HLUB	Limited	Biomarker	[3]

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Amphotericin B	DMTAJQE	Approved	Amphotericin B increases the expression of Carcinoembryonic antigen-related cell adhesion molecule 21 (CEACAM21).	[4]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Carcinoembryonic antigen-related cell adhesion molecule 21 (CEACAM21).	[5]

References

• [1] Carcinoembryonic antigen-related cell adhesion molecules as surrogate markers for EGFR inhibitor sensitivity in human lung adenocarcinoma.Br J Cancer. 2012 Nov 6;107(10):1745-53. doi: 10.1038/bjc.2012.422. Epub 2012 Oct 25.
• [2] DOCK4 and CEACAM21 as novel schizophrenia candidate genes in the Jewish population.Int J Neuropsychopharmacol. 2012 May;15(4):459-69. doi: 10.1017/S1461145711000903. Epub 2011 Jun 20.
• [3] Analysis of 19 genes for association with type I diabetes in the Type I Diabetes Genetics Consortium families.Genes Immun. 2009 Dec;10 Suppl 1(Suppl 1):S74-84. doi: 10.1038/gene.2009.96.
• [4] Differential expression of microRNAs and their predicted targets in renal cells exposed to amphotericin B and its complex with copper (II) ions. Toxicol Mech Methods. 2017 Sep;27(7):537-543. doi: 10.1080/15376516.2017.1333554. Epub 2017 Jun 8.
• [5] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.