Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTHZ4RKK)

• DOT Name: RIPOR family member 3 (RIPOR3)
• Gene Name: RIPOR3
• Related Disease:
  Colon cancer
  Colorectal adenocarcinoma
  Colorectal adenoma
  Colorectal cancer
  Colorectal cancer, susceptibility to, 1
  Colorectal cancer, susceptibility to, 10
  Colorectal cancer, susceptibility to, 12
  Colorectal carcinoma
  Colorectal neoplasm
• UniProt ID: RIPR3_HUMAN
• Pfam ID: PF15903
• Sequence:
  MSVRLRFLSPGDTGAVGVVGRSASFAGFSSAQSRRIAKSINRNSVRSRMPAKSSKMYGTL
  RKGSVCADPKPQQVKKIFEALKRGLKEYLCVQQAELDHLSGRHKDTRRNSRLAFYYDLDK
  QTRCVERHIRKMEFHISKVDELYEDYCIQCRLRDGASSMQRAFARCPPSRAARESLQELG
  RSLHECAEDMWLIEGALEVHLGEFHIRMKGLVGYARLCPGDHYEVLMRLGRQRWKLKGRI
  ESDDSQTWDEEEKAFIPTLHENLDIKVTELRGLGSLAVGAVTCDIADFFTTRPQVIVVDI
  TELGTIKLQLEVQWNPFDTESFLVSPSPTGKFSMGSRKGSLYNWTPPSTPSFRERYYLSV
  LQQPTQQALLLGGPRATSILSYLSDSDLRGPSLRSQSQELPEMDSFSSEDPRDTETSTSA
  STSDVGFLPLTFGPHASIEEEAREDPLPPGLLPEMAHLSGGPFAEQPGWRNLGGESPSLP
  QGSLFHSGTASSSQNGHEEGATGDREDGPGVALEGPLQEVLELLRPTDSTQPQLRELEYQ
  VLGFRDRLKPCRARQEHTSAESLMECILESFAFLNADFALDELSLFGGSQGLRKDRPLPP
  PSSLKASSRELTAGAPELDVLLMVHLQVCKALLQKLASPNLSRLVQECLLEEVAQQKHVL
  ETLSVLDFEKVGKATSIEEIIPQASRTKGCLKLWRGCTGPGRVLSCPATTLLNQLKKTFQ
  HRVRGKYPGQLEIACRRLLEQVVSCGGLLPGAGLPEEQIITWFQFHSYLQRQSVSDLEKH
  FTQLTKEVTLIEELHCAGQAKVVRKLQGKRLGQLQPLPQTLRAWALLQLDGTPRVCRAAS
  ARLAGAVRNRSFREKALLFYTNALAENDARLQQAACLALKHLKGIESIDQTASLCQSDLE
  AVRAAARETTLSFGEKGRLAFEKMDKLCSEQREVFCQEADVEITIF

Molecular Interaction Atlas (MIA) of This DOT

9 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Colon cancer	DISVC52G	Strong	Genetic Variation	[1]
Colorectal adenocarcinoma	DISPQOUB	Strong	Genetic Variation	[1]
Colorectal adenoma	DISTSVHM	Strong	Genetic Variation	[1]
Colorectal cancer	DISNH7P9	Strong	Genetic Variation	[1]
Colorectal cancer, susceptibility to, 1	DISZ794C	Strong	Genetic Variation	[1]
Colorectal cancer, susceptibility to, 10	DISQXMYM	Strong	Genetic Variation	[1]
Colorectal cancer, susceptibility to, 12	DIS4FXJX	Strong	Genetic Variation	[1]
Colorectal carcinoma	DIS5PYL0	Strong	Genetic Variation	[1]
Colorectal neoplasm	DISR1UCN	Strong	Genetic Variation	[1]

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate affects the expression of RIPOR family member 3 (RIPOR3).	[2]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of RIPOR family member 3 (RIPOR3).	[3]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of RIPOR family member 3 (RIPOR3).	[4]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of RIPOR family member 3 (RIPOR3).	[5]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the expression of RIPOR family member 3 (RIPOR3).	[6]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of RIPOR family member 3 (RIPOR3).	[7]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of RIPOR family member 3 (RIPOR3).	[9]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of RIPOR family member 3 (RIPOR3).	[8]

References

• [1] Discovery of common and rare genetic risk variants for colorectal cancer.Nat Genet. 2019 Jan;51(1):76-87. doi: 10.1038/s41588-018-0286-6. Epub 2018 Dec 3.
• [2] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [3] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [4] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [5] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [6] Benzo[a]pyrene-induced changes in microRNA-mRNA networks. Chem Res Toxicol. 2012 Apr 16;25(4):838-49.
• [7] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [8] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [9] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.