Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OTIHSXO8)
| DOT Name | Ileal sodium/bile acid cotransporter (SLC10A2) | ||||
|---|---|---|---|---|---|
| Synonyms |
Apical sodium-dependent bile acid transporter; ASBT; Ileal Na(+)/bile acid cotransporter; Ileal sodium-dependent bile acid transporter; IBAT; ISBT; Na(+)-dependent ileal bile acid transporter; Sodium/taurocholate cotransporting polypeptide, ileal; Solute carrier family 10 member 2
|
||||
| Gene Name | SLC10A2 | ||||
| Related Disease | |||||
| UniProt ID | |||||
| 3D Structure | |||||
| Pfam ID | |||||
| Sequence |
MNDPNSCVDNATVCSGASCVVPESNFNNILSVVLSTVLTILLALVMFSMGCNVEIKKFLG
HIKRPWGICVGFLCQFGIMPLTGFILSVAFDILPLQAVVVLIIGCCPGGTASNILAYWVD GDMDLSVSMTTCSTLLALGMMPLCLLIYTKMWVDSGSIVIPYDNIGTSLVSLVVPVSIGM FVNHKWPQKAKIILKIGSIAGAILIVLIAVVGGILYQSAWIIAPKLWIIGTIFPVAGYSL GFLLARIAGLPWYRCRTVAFETGMQNTQLCSTIVQLSFTPEELNVVFTFPLIYSIFQLAF AAIFLGFYVAYKKCHGKNKAEIPESKENGTEPESSFYKANGGFQPDEK |
||||
| Function |
Plays a critical role in the sodium-dependent reabsorption of bile acids from the lumen of the small intestine. Transports various bile acids, unconjugated or conjugated, such as cholate and taurocholate. Also responsible for bile acid transport in the renal proximal tubules, a salvage mechanism that helps conserve bile acids (Probable). Works collaboratively with the Na(+)-taurocholate cotransporting polypeptide (NTCP), the organic solute transporter (OST), and the bile salt export pump (BSEP), to ensure efficacious biological recycling of bile acids during enterohepatic circulation.
|
||||
| Tissue Specificity | Mainly expressed in ileum and kidney, lower expression in cecum. | ||||
| KEGG Pathway | |||||
| Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DOT
|
1 Disease(s) Related to This DOT
|
|||||||||||||||||||||||||||||||||||
| Molecular Interaction Atlas (MIA) | |||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
This DOT Affected the Regulation of Drug Effects of 1 Drug(s)
|
|||||||||||||||||||||||||||||||||||
|
3 Drug(s) Affected the Gene/Protein Processing of This DOT
|
|||||||||||||||||||||||||||||||||||
References
