Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTIVX9UM)

DOT Name	Beta-defensin 108B (DEFB108B)
Synonyms	Beta-defensin 8; BD-8; DEFB-8; hBD-8; Defensin, beta 108; Defensin, beta 108B
Gene Name	DEFB108B
UniProt ID	D108B_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF13841
Sequence	MRIAVLLFAIFFFMSQVLPARGKFKEICERPNGSCRDFCLETEIHVGRCLNSQPCCLPLG HQPRIESTTPKKD
Function	Has antibacterial activity.
Tissue Specificity	Specifically expressed in testis. Low expression is detected also in liver.
Reactome Pathway	Defensins (R-HSA-1461973 ) Beta defensins (R-HSA-1461957 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Beta-defensin 108B (DEFB108B).	[1]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Malathion	DMXZ84M	Approved	Malathion increases the expression of Beta-defensin 108B (DEFB108B).	[2]
------------------------------------------------------------------------------------

References

1	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
2	Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.