Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTIWALXH)

• DOT Name: Ferritin heavy polypeptide-like 17 (FTHL17)
• Synonyms: Cancer/testis antigen 38; CT38
• Gene Name: FTHL17
• Related Disease:
  46,XY complete gonadal dysgenesis
  Colorectal adenoma
  Lung cancer
  Lung carcinoma
• UniProt ID: FHL17_HUMAN
• Pfam ID: PF00210
• Sequence:
  MATAQPSQVRQKYDTNCDAAINSHITLELYTSYLYLSMAFYFNRDDVALENFFRYFLRLS
  DDKMEHAQKLMRLQNLRGGHICLHDIRKPECQGWESGLVAMESAFHLEKNVNQSLLDLYQ
  LAVEKGDPQLCHFLESHYLHEQVKTIKELGGYVSNLRKICSPEAGLAEYLFDKLTLGGRV
  KET
• Tissue Specificity: Testis specific. Also expressed in several cancers.

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
46,XY complete gonadal dysgenesis	DISLF3LT	Strong	Genetic Variation	[1]
Colorectal adenoma	DISTSVHM	Disputed	Biomarker	[2]
Lung cancer	DISCM4YA	Limited	Altered Expression	[3]
Lung carcinoma	DISTR26C	Limited	Altered Expression	[3]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Ferritin heavy polypeptide-like 17 (FTHL17).	[4]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Ferritin heavy polypeptide-like 17 (FTHL17).	[6]

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Ferritin heavy polypeptide-like 17 (FTHL17).	[5]

References

• [1] Novel mutation in FTHL17 gene in pedigree with 46,XY pure gonadal dysgenesis.Fertil Steril. 2019 Jun;111(6):1226-1235.e1. doi: 10.1016/j.fertnstert.2019.01.027. Epub 2019 Mar 25.
• [2] Exome capture sequencing of adenoma reveals genetic alterations in multiple cellular pathways at the early stage of colorectal tumorigenesis.PLoS One. 2013;8(1):e53310. doi: 10.1371/journal.pone.0053310. Epub 2013 Jan 2.
• [3] DNA methylation of the Fthl17 5'-upstream region regulates differential Fthl17 expression in lung cancer cells and germline stem cells.PLoS One. 2017 Feb 16;12(2):e0172219. doi: 10.1371/journal.pone.0172219. eCollection 2017.
• [4] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [5] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [6] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.