Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTIXMOUN)

• DOT Name: Olfactory receptor 5P3 (OR5P3)
• Synonyms: Olfactory receptor OR11-94; Olfactory receptor-like protein JCG1
• Gene Name: OR5P3
• UniProt ID: OR5P3_HUMAN
• Pfam ID: PF13853
• Sequence:
  MGTGNDTTVVEFTLLGLSEDTTVCAILFLVFLGIYVVTLMGNISIIVLIRRSHHLHTPMY
  IFLCHLAFVDIGYSSSVTPVMLMSFLRKETSLPVAGCVAQLCSVVTFGTAECFLLAAMAY
  DRYVAICSPLLYSTCMSPGVCIILVGMSYLGGCVNAWTFIGCLLRLSFCGPNKVNHFFCD
  YSPLLKLACSHDFTFEIIPAISSGSIIVATVCVIAISYIYILITILKMHSTKGRHKAFST
  CTSHLTAVTLFYGTITFIYVMPKSSYSTDQNKVVSVFYTVVIPMLNPLIYSLRNKEIKGA
  LKRELRIKIFS
• Function: Odorant receptor (Potential). May be involved in taste perception.
• Tissue Specificity: Expressed in the tongue.
• KEGG Pathway: Olfactory transduction (hsa04740)
• Reactome Pathway:
  Expression and translocation of olfactory receptors (R-HSA-9752946)
  Olfactory Signaling Pathway (R-HSA-381753)

Molecular Interaction Atlas (MIA) of This DOT

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Olfactory receptor 5P3 (OR5P3).	[1]
Ethanol	DMDRQZU	Approved	Ethanol increases the expression of Olfactory receptor 5P3 (OR5P3).	[2]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Olfactory receptor 5P3 (OR5P3).	[4]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Olfactory receptor 5P3 (OR5P3).	[3]

References

• [1] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [2] Chronic ethanol exposure increases goosecoid (GSC) expression in human embryonic carcinoma cell differentiation. J Appl Toxicol. 2014 Jan;34(1):66-75.
• [3] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [4] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.