Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OTJ9E3R7)
| DOT Name | Keratin-associated protein 5-9 (KRTAP5-9) | ||||
|---|---|---|---|---|---|
| Synonyms | Keratin, cuticle, ultrahigh sulfur 1; Keratin, ultra high-sulfur matrix protein A; Keratin-associated protein 5.9; UHS keratin A; UHS KerA; Ultrahigh sulfur keratin-associated protein 5.9 | ||||
| Gene Name | KRTAP5-9 | ||||
| Related Disease | |||||
| UniProt ID | |||||
| 3D Structure | |||||
| Sequence |
MGCCGCSGGCGSSCGGCDSSCGSCGSGCRGCGPSCCAPVYCCKPVCCCVPACSCSSCGKR
GCGSCGGSKGGCGSCGCSQCSCCKPCCCSSGCGSSCCQCSCCKPYCSQCSCCKPCCSSSG RGSSCCQSSCCKPCCSSSGCGSSCCQSSCCKPCCSQSRCCVPVCYQCKI |
||||
| Function |
In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated protein (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.
|
||||
| Tissue Specificity | Restricted to hair root, not detected in any other tissues. Expressed in cuticle layers of differentiating hair follicles. | ||||
| Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DOT
|
2 Disease(s) Related to This DOT
|
|||||||||||||||||||||||||||||||
| Molecular Interaction Atlas (MIA) | |||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
1 Drug(s) Affected the Post-Translational Modifications of This DOT
|
|||||||||||||||||||||||||||||||
|
1 Drug(s) Affected the Gene/Protein Processing of This DOT
|
|||||||||||||||||||||||||||||||
References
