Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTJDKMRD)

• DOT Name: Spermatogenesis-associated serine-rich protein 2 (SPATS2)
• Synonyms: Serine-rich spermatocytes and round spermatid 59 kDa protein; p59scr
• Gene Name: SPATS2
• UniProt ID: SPAS2_HUMAN
• Pfam ID: PF07139
• Sequence:
  MSRKQNQKDSSGFIFDLQSNTVLAQGGAFENMKEKINAVRAIVPNKSNNEIILVLQHFDN
  CVDKTVQAFMEGSASEVLKEWTVTGKKKNKKKKNKPKPAAEPSNGIPDSSKSVSIQEEQS
  APSSEKGGMNGYHVNGAINDTESVDSLSEGLETLSIDARELEDPESAMLDTLDRTGSMLQ
  NGVSDFETKSLTMHSIHNSQQPRNAAKSLSRPTTETQFSNMGMEDVPLATSKKLSSNIEK
  SVKDLQRCTVSLARYRVVVKEEMDASIKKMKQAFAELESCLMDREVALLAEMDKVKAEAM
  EILLSRQKKAELLKKMTHVAVQMSEQQLVELRADIKHFVSERKYDEDLGRVARFTCDVET
  LKKSIDSFGQVSHPKNSYSTRSRCSSVTSVSLSSPSDASAASSSTCASPPSLTSANKKNF
  APGETPAAIANSSGQPYQPLREVLPGNRRGGQGYRPQGQKSNDPMNQGRHDSMGRYRNSS
  WYSSGSRYQSAPSQAPGNTIERGQTHSAGTNGTGVSMEPSPPTPSFKKGLPQRKPRTSQT
  EAVNS

Molecular Interaction Atlas (MIA) of This DOT

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Spermatogenesis-associated serine-rich protein 2 (SPATS2).	[1]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Spermatogenesis-associated serine-rich protein 2 (SPATS2).	[2]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Spermatogenesis-associated serine-rich protein 2 (SPATS2).	[4]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Spermatogenesis-associated serine-rich protein 2 (SPATS2).	[5]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Spermatogenesis-associated serine-rich protein 2 (SPATS2).	[6]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Spermatogenesis-associated serine-rich protein 2 (SPATS2).	[3]

References

• [1] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [2] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [3] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [4] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [5] Microarray analysis of bisphenol A-induced changes in gene expression in human oral epithelial cells. Acta Biochim Biophys Sin (Shanghai). 2007 Nov;39(11):879-84. doi: 10.1111/j.1745-7270.2007.00351.x.
• [6] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.