Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTJFDTVR)

• DOT Name: LRRN4 C-terminal-like protein (LRRN4CL)
• Gene Name: LRRN4CL
• UniProt ID: LRN4L_HUMAN
• Sequence:
  MLGSPCLLWLLAVTFLVPRAQPLAPQDFEEEEADETETAWPPLPAVPCDYDHCRHLQVPC
  KELQRVGPAACLCPGLSSPAQPPDPPRMGEVRIAAEEGRAVVHWCAPFSPVLHYWLLLWD
  GSEAAQKGPPLNATVRRAELKGLKPGGIYVVCVVAANEAGASRVPQAGGEGLEGADIPAF
  GPCSRLAVPPNPRTLVHAAVGVGTALALLSCAALVWHFCLRDRWGCPRRAAARAAGAL

Molecular Interaction Atlas (MIA) of This DOT

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of LRRN4 C-terminal-like protein (LRRN4CL).	[1]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of LRRN4 C-terminal-like protein (LRRN4CL).	[2]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of LRRN4 C-terminal-like protein (LRRN4CL).	[3]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of LRRN4 C-terminal-like protein (LRRN4CL).	[5]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of LRRN4 C-terminal-like protein (LRRN4CL).	[6]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of LRRN4 C-terminal-like protein (LRRN4CL).	[4]

References

• [1] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [2] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [3] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [4] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [5] Bisphenol A and bisphenol S induce distinct transcriptional profiles in differentiating human primary preadipocytes. PLoS One. 2016 Sep 29;11(9):e0163318.
• [6] Regulation of chromatin assembly and cell transformation by formaldehyde exposure in human cells. Environ Health Perspect. 2017 Sep 21;125(9):097019.