Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTJGDN94)

• DOT Name: Vacuolar fusion protein MON1 homolog B (MON1B)
• Synonyms: HSV-1 stimulation-related gene 1 protein; HSV-I stimulating-related protein
• Gene Name: MON1B
• Related Disease:
  Colon cancer
  Colon carcinoma
  Herpes simplex infection
• UniProt ID: MON1B_HUMAN
• Pfam ID: PF19036 ; PF19037 ; PF19038
• Sequence:
  MEVGGDTAAPAPGGAEDLEDTQFPSEEAREGGGVHAVPPDPEDEGLEETGSKDKDQPPSP
  SPPPQSEALSSTSRLWSPAAPENSPTCSPESSSGGQGGDPSDEEWRSQRKHVFVLSEAGK
  PIYSRYGSVEALSATMGVMTALVSFVQSAGDAIRAIYAEDHKLVFLQQGPLLLVAMSRTS
  QSAAQLRGELLAVHAQIVSTLTRASVARIFAHKQNYDLRRLLAGSERTLDRLLDSMEQDP
  GALLLGAVRCVPLARPLRDALGALLRRCTAPGLALSVLAVGGRLITAAQERNVLAECRLD
  PADLQLLLDWVGAPAFAAGEAWAPVCLPRFNPDGFFYAYVARLDAMPVCLLLLGTQREAF
  HAMAACRRLVEDGMHALGAMRALGEAASFSNASSASAPAYSVQAVGAPGLRHFLYKPLDI
  PDHHRQLPQFTSPELEAPYSREEERQRLSDLYHRLHARLHSTSRPLRLIYHVAEKETLLA
  WVTSKFELYTCLSPLVTKAGAILVVTKLLRWVKKEEDRLFIRYPPKYSTPPATSTDQAAH
  NGLFTGL
• KEGG Pathway: Mitophagy - animal (hsa04137)
• Reactome Pathway: RAB GEFs exchange GTP for GDP on RABs (R-HSA-8876198)

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Colon cancer	DISVC52G	Strong	Altered Expression	[1]
Colon carcinoma	DISJYKUO	Strong	Altered Expression	[1]
Herpes simplex infection	DISL1SAV	Strong	Biomarker	[2]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Vacuolar fusion protein MON1 homolog B (MON1B).	[3]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the phosphorylation of Vacuolar fusion protein MON1 homolog B (MON1B).	[8]
Coumarin	DM0N8ZM	Investigative	Coumarin increases the phosphorylation of Vacuolar fusion protein MON1 homolog B (MON1B).	[8]

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Vacuolar fusion protein MON1 homolog B (MON1B).	[4]
Selenium	DM25CGV	Approved	Selenium increases the expression of Vacuolar fusion protein MON1 homolog B (MON1B).	[5]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Vacuolar fusion protein MON1 homolog B (MON1B).	[6]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Vacuolar fusion protein MON1 homolog B (MON1B).	[7]
PMID28870136-Compound-48	DMPIM9L	Patented	PMID28870136-Compound-48 decreases the expression of Vacuolar fusion protein MON1 homolog B (MON1B).	[9]

References

• [1] Knockdown of MON1B Exerts Anti-Tumor Effects in Colon Cancer In Vitro.Med Sci Monit. 2018 Oct 28;24:7710-7718. doi: 10.12659/MSM.911002.
• [2] Identification of a novel human sand family protein in human fibroblasts induced by herpes simplex virus 1 binding.Acta Virol. 2003;47(1):27-32.
• [3] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [4] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [5] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [6] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [7] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [8] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [9] Oxidative stress modulates theophylline effects on steroid responsiveness. Biochem Biophys Res Commun. 2008 Dec 19;377(3):797-802.