Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTJMFF0A)

• DOT Name: Spermatogenesis-associated protein 25 (SPATA25)
• Synonyms: Testis-specific gene 23 protein
• Gene Name: SPATA25
• Related Disease: Azoospermia
• UniProt ID: SPT25_HUMAN
• Pfam ID: PF15218
• Sequence:
  MSYFRTPQTHPGPLPSGQGGAASPGLSLGLCSPVEPVVVASGGTGPLSQKAEQVAPAAQA
  WGPALAMPQARGCPGGTSWETLRKEYSRNCHKFPHVRQLESLGWDNGYSRSRAPDLGGPS
  RPRPLMLCGLSPRVLPVPSEAVGKEASSQPDICILTLAMMIAGIPTVPVPGVREEDLIWA
  AQAFMMAHPEPEGAVEGARWEQAHAHTASGKMPLVRSKRGQPPGSCL
• Function: May play a role in spermatogenesis.
• Tissue Specificity: Expressed predominantly in testis (at protein level). Expression is lower in patients with obstructive azoospermia than in fertile controls and is not detected in patients with non-obstructive azoospermia.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Azoospermia	DIS94181	Strong	Altered Expression	[1]

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Spermatogenesis-associated protein 25 (SPATA25).	[2]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil increases the expression of Spermatogenesis-associated protein 25 (SPATA25).	[3]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Spermatogenesis-associated protein 25 (SPATA25).	[4]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Spermatogenesis-associated protein 25 (SPATA25).	[5]
KOJIC ACID	DMP84CS	Investigative	KOJIC ACID decreases the expression of Spermatogenesis-associated protein 25 (SPATA25).	[6]

References

• [1] Developmental expression pattern of a novel gene, TSG23/Tsg23, suggests a role in spermatogenesis.Mol Hum Reprod. 2009 Apr;15(4):223-30. doi: 10.1093/molehr/gap015. Epub 2009 Feb 24.
• [2] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [3] Identification of novel genes associated with the response to 5-FU treatment in gastric cancer cell lines using a cDNA microarray. Cancer Lett. 2004 Oct 8;214(1):19-33.
• [4] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [5] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [6] Toxicogenomics of kojic acid on gene expression profiling of a375 human malignant melanoma cells. Biol Pharm Bull. 2006 Apr;29(4):655-69.