Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTKNFPUY)

• DOT Name: Cysteine and tyrosine-rich protein 1 (CYYR1)
• Synonyms: Proline-rich domain-containing protein
• Gene Name: CYYR1
• Related Disease:
  Neoplasm
  Neuroendocrine neoplasm
• UniProt ID: CYYR1_HUMAN
• Pfam ID: PF10873
• Sequence:
  MDAPRLPVRPGVLLPKLVLLFVYADDCLAQCGKDCKSYCCDGTTPYCCSYYAYIGNILSG
  TAIAGIVFGIVFIMGVIAGIAICICMCMKNHRATRVGILRTTHINTVSSYPGPPPYGHDH
  EMEYCADLPPPYSPTPQGPAQRSPPPPYPGNARK
• Tissue Specificity: Widely expressed.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Neoplasm	DISZKGEW	Limited	Altered Expression	[1]
Neuroendocrine neoplasm	DISNPLOO	Limited	Altered Expression	[1]

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Cysteine and tyrosine-rich protein 1 (CYYR1).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Cysteine and tyrosine-rich protein 1 (CYYR1).	[3]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Cysteine and tyrosine-rich protein 1 (CYYR1).	[4]
Ethanol	DMDRQZU	Approved	Ethanol decreases the expression of Cysteine and tyrosine-rich protein 1 (CYYR1).	[5]
Permethrin	DMZ0Q1G	Approved	Permethrin decreases the expression of Cysteine and tyrosine-rich protein 1 (CYYR1).	[6]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Cysteine and tyrosine-rich protein 1 (CYYR1).	[8]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Cysteine and tyrosine-rich protein 1 (CYYR1).	[7]

References

• [1] Sequence, "subtle" alternative splicing and expression of the CYYR1 (cysteine/tyrosine-rich 1) mRNA in human neuroendocrine tumors.BMC Cancer. 2007 Apr 18;7:66. doi: 10.1186/1471-2407-7-66.
• [2] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [3] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [4] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [5] Chronic ethanol exposure increases goosecoid (GSC) expression in human embryonic carcinoma cell differentiation. J Appl Toxicol. 2014 Jan;34(1):66-75.
• [6] Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
• [7] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [8] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.