Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTKOYVKF)

DOT Name	Ciliary microtubule inner protein 1 (CIMIP1)
Gene Name	CIMIP1
UniProt ID	CMIP1_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF14945
Sequence	MAQKPLSTAAAERMNLVGQDEIWKYRLKAESEARQNWPQNWGFLTTPFEELIKCEEDLPT PKPKIELPERFRIRPVTPVEKYIKVFPSPPVPQTTQGFIGWRSAVPGLNKCLELDDAIRS CKGAFARELCWPKQGVH
Tissue Specificity	Expressed in airway epithelial cells, renal tubular cells, pancreatic acinar cells and epithelial cells of the stomach, duodenum, and gallbladder (at protein level).

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Ciliary microtubule inner protein 1 (CIMIP1).	[1]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Ciliary microtubule inner protein 1 (CIMIP1).	[2]
------------------------------------------------------------------------------------

References

1	Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
2	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.