Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTKX1KEC)

DOT Name GRB2-associated-binding protein 3 (GAB3)
Synonyms GRB2-associated binder 3; Growth factor receptor bound protein 2-associated protein 3
Gene Name GAB3
Related Disease
Advanced cancer ( )
Colitis ( )
Colorectal carcinoma ( )
Glioma ( )
Hemochromatosis ( )
Neoplasm ( )
Type-1 diabetes ( )
UniProt ID
GAB3_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00169
Sequence
MSAGDAVCTGWLVKSPPERKLQRYAWRKRWFVLRRGRMSGNPDVLEYYRNKHSSKPIRVI
DLSECAVWKHVGPSFVRKEFQNNFVFIVKTTSRTFYLVAKTEQEMQVWVHSISQVCNLGH
LEDGADSMESLSYTPSSLQPSSASSLLTAHAASSSLPRDDPNTNAVATEETRSESELLFL
PDYLVLSNCETGRLHHTSLPTRCDSWSNSDRSLEQASFDDVFVDCLQPLPSSHLVHPSCH
GSGAQEVPSSRPQAALIWSREINGPPRDHLSSSPLLESSLSSTIQVDKNQGSLPCGAKEL
DIMSNTPPPRPPKPSHLSERRQEEWSTHSGSKKPECTLVPRRISLSGLDNMRTWKADVEG
QSLRHRDKRLSLNLPCRFSPMYPTASASIEDSYVPMSPQAGASGLGPHCSPDDYIPMNSG
SISSPLPELPANLEPPPVNRDLKPQRKSRPPPLDLRNLSIIREHASLTRTRTVPCSRTSF
LSPERNGINSARFFANPVSREDEESYIEMEEHRTASSLSSGALTWTKKFSLDYLALDFNS
ASPAPMQQKLLLSEEQRVDYVQVDEQKTQALQSTKQEWTDERQSKV
Reactome Pathway
Signaling by CSF1 (M-CSF) in myeloid cells (R-HSA-9680350 )

Molecular Interaction Atlas (MIA) of This DOT

7 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Advanced cancer DISAT1Z9 Strong Altered Expression [1]
Colitis DISAF7DD Strong Biomarker [2]
Colorectal carcinoma DIS5PYL0 Strong Altered Expression [3]
Glioma DIS5RPEH Strong Altered Expression [1]
Hemochromatosis DISAPY0H Strong Genetic Variation [4]
Neoplasm DISZKGEW Strong Altered Expression [1]
Type-1 diabetes DIS7HLUB Strong Genetic Variation [5]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
6 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin increases the expression of GRB2-associated-binding protein 3 (GAB3). [6]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of GRB2-associated-binding protein 3 (GAB3). [7]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of GRB2-associated-binding protein 3 (GAB3). [8]
Triclosan DMZUR4N Approved Triclosan decreases the expression of GRB2-associated-binding protein 3 (GAB3). [9]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of GRB2-associated-binding protein 3 (GAB3). [11]
Maleic Acid DM4L0R7 Investigative Maleic Acid increases the expression of GRB2-associated-binding protein 3 (GAB3). [12]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of GRB2-associated-binding protein 3 (GAB3). [10]
------------------------------------------------------------------------------------

References

1 Gab3 overexpression in human glioma mediates Akt activation and tumor cell proliferation.PLoS One. 2017 Mar 14;12(3):e0173473. doi: 10.1371/journal.pone.0173473. eCollection 2017.
2 Gab2 and Gab3 Redundantly Suppress Colitis by Modulating Macrophage and CD8(+) T-Cell Activation.Front Immunol. 2019 Mar 18;10:486. doi: 10.3389/fimmu.2019.00486. eCollection 2019.
3 Gab3 is required for human colorectal cancer cell proliferation.Biochem Biophys Res Commun. 2017 Mar 18;484(4):719-725. doi: 10.1016/j.bbrc.2017.01.095. Epub 2017 Jan 20.
4 Genome-wide association study of iron traits and relation to diabetes in the Hispanic Community Health Study/Study of Latinos (HCHS/SOL): potential genomic intersection of iron and glucose regulation?.Hum Mol Genet. 2017 May 15;26(10):1966-1978. doi: 10.1093/hmg/ddx082.
5 Genome-wide association study and meta-analysis find that over 40 loci affect risk of type 1 diabetes.Nat Genet. 2009 Jun;41(6):703-7. doi: 10.1038/ng.381. Epub 2009 May 10.
6 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
7 Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
8 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
9 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
10 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
11 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
12 Profiling transcriptomes of human SH-SY5Y neuroblastoma cells exposed to maleic acid. PeerJ. 2017 Apr 5;5:e3175.