Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTKXKZ40)

DOT Name	Keratin-associated protein 8-1 (KRTAP8-1)
Synonyms	High glycine-tyrosine keratin-associated protein 8.1
Gene Name	KRTAP8-1
Related Disease	Lung adenocarcinoma ( )
UniProt ID	KRA81_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF11759
Sequence	MLCDNFPGAVFPGCYWGSYGYPLGYSVGCGYGSTYSPVGYGFGYGYNGCGAFGYRRYSPF ALY
Function	In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.
Tissue Specificity	Is essentially restricted to only one vertical half of the hair forming compartment and in beard hairs is absent from the central medulla.
Reactome Pathway	Keratinization (R-HSA-6805567 )

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance		REF
Lung adenocarcinoma	DISD51WR	Strong	Biomarker	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Keratin-associated protein 8-1 (KRTAP8-1).	[2]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Keratin-associated protein 8-1 (KRTAP8-1).	[3]
------------------------------------------------------------------------------------

References

1	A Diagnostic Panel of DNA Methylation Biomarkers for Lung Adenocarcinoma.Front Oncol. 2019 Dec 3;9:1281. doi: 10.3389/fonc.2019.01281. eCollection 2019.
2	Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
3	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.