Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTKZHTZ5)

DOT Name FYVE and coiled-coil domain-containing protein 1 (FYCO1)
Synonyms Zinc finger FYVE domain-containing protein 7
Gene Name FYCO1
Related Disease
Cataract 18 ( )
Parkinson disease ( )
Advanced cancer ( )
Myopathy ( )
Psoriasis ( )
Early-onset nuclear cataract ( )
Total early-onset cataract ( )
Inclusion body myositis ( )
UniProt ID
FYCO1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
5CX3; 5D94; 7BQI
Pfam ID
PF01363 ; PF02759
Sequence
MASTNAESQLQRIIRDLQDAVTELSKEFQEAGEPITDDSTSLHKFSYKLEYLLQFDQKEK
ATLLGNKKDYWDYFCACLAKVKGANDGIRFVKSISELRTSLGKGRAFIRYSLVHQRLADT
LQQCFMNTKVTSDWYYARSPFLQPKLSSDIVGQLYELTEVQFDLASRGFDLDAAWPTFAR
RTLTTGSSAYLWKPPSRSSSMSSLVSSYLQTQEMVSNFDLNSPLNNEALEGFDEMRLELD
QLEVREKQLRERMQQLDRENQELRAAVSQQGEQLQTERERGRTAAEDNVRLTCLVAELQK
QWEVTQATQNTVKELQTCLQGLELGAAEKEEDYHTALRRLESMLQPLAQELEATRDSLDK
KNQHLASFPGWLAMAQQKADTASDTKGRQEPIPSDAAQEMQELGEKLQALERERTKVEEV
NRQQSAQLEQLVKELQLKEDARASLERLVKEMAPLQEELSGKGQEADQLWRRLQELLAHT
SSWEEELAELRREKKQQQEEKELLEQEVRSLTRQLQFLETQLAQVSQHVSDLEEQKKQLI
QDKDHLSQQVGMLERLAGPPGPELPVAGEKNEALVPVNSSLQEAWGKPEEEQRGLQEAQL
DDTKVQEGSQEEELRQANRELEKELQNVVGRNQLLEGKLQALQADYQALQQRESAIQGSL
ASLEAEQASIRHLGDQMEASLLAVRKAKEAMKAQMAEKEAILQSKEGECQQLREEVEQCQ
QLAEARHRELRALESQCQQQTQLIEVLTAEKGQQGVGPPTDNEARELAAQLALSQAQLEV
HQGEVQRLQAQVVDLQAKMRAALDDQDKVQSQLSMAEAVLREHKTLVQQLKEQNEALNRA
HVQELLQCSEREGALQEERADEAQQREEELRALQEELSQAKCSSEEAQLEHAELQEQLHR
ANTDTAELGIQVCALTVEKERVEEALACAVQELQDAKEAASREREGLERQVAGLQQEKES
LQEKLKAAKAAAGSLPGLQAQLAQAEQRAQSLQEAAHQELNTLKFQLSAEIMDYQSRLKN
AGEECKSLRGQLEEQGRQLQAAEEAVEKLKATQADMGEKLSCTSNHLAECQAAMLRKDKE
GAALREDLERTQKELEKATTKIQEYYNKLCQEVTNRERNDQKMLADLDDLNRTKKYLEER
LIELLRDKDALWQKSDALEFQQKLSAEERWLGDTEANHCLDCKREFSWMVRRHHCRICGR
IFCYYCCNNYVLSKHGGKKERCCRACFQKLSEGPGSPDSSGSGTSQGEPSPALSPASPGP
QATGGQGANTDYRPPDDAVFDIITDEELCQIQESGSSLPETPTETDSLDPNAAEQDTTST
SLTPEDTEDMPVGQDSEICLLKSGELMIKVPLTVDEIASFGEGSRELFVRSSTYSLIPIT
VAEAGLTISWVFSSDPKSISFSVVFQEAEDTPLDQCKVLIPTTRCNSHKENIQGQLKVRT
PGIYMLIFDNTFSRFVSKKVFYHLTVDRPVIYDGSDFL
Function May mediate microtubule plus end-directed vesicle transport.
Tissue Specificity Expressed in heart and skeletal muscle.
KEGG Pathway
Salmonella infection (hsa05132 )

Molecular Interaction Atlas (MIA) of This DOT

8 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Cataract 18 DISHDLPB Definitive Autosomal recessive [1]
Parkinson disease DISQVHKL Definitive Biomarker [2]
Advanced cancer DISAT1Z9 Strong Biomarker [3]
Myopathy DISOWG27 Strong Biomarker [4]
Psoriasis DIS59VMN Strong Biomarker [5]
Early-onset nuclear cataract DISGIHUY Supportive Autosomal dominant [1]
Total early-onset cataract DISACMEZ Supportive Autosomal dominant [6]
Inclusion body myositis DISZXXG5 Limited Genetic Variation [7]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
12 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of FYVE and coiled-coil domain-containing protein 1 (FYCO1). [8]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of FYVE and coiled-coil domain-containing protein 1 (FYCO1). [9]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of FYVE and coiled-coil domain-containing protein 1 (FYCO1). [10]
Estradiol DMUNTE3 Approved Estradiol increases the expression of FYVE and coiled-coil domain-containing protein 1 (FYCO1). [11]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of FYVE and coiled-coil domain-containing protein 1 (FYCO1). [12]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide increases the expression of FYVE and coiled-coil domain-containing protein 1 (FYCO1). [13]
Dexamethasone DMMWZET Approved Dexamethasone increases the expression of FYVE and coiled-coil domain-containing protein 1 (FYCO1). [14]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of FYVE and coiled-coil domain-containing protein 1 (FYCO1). [15]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of FYVE and coiled-coil domain-containing protein 1 (FYCO1). [17]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the expression of FYVE and coiled-coil domain-containing protein 1 (FYCO1). [18]
Milchsaure DM462BT Investigative Milchsaure decreases the expression of FYVE and coiled-coil domain-containing protein 1 (FYCO1). [19]
Coumestrol DM40TBU Investigative Coumestrol decreases the expression of FYVE and coiled-coil domain-containing protein 1 (FYCO1). [20]
------------------------------------------------------------------------------------
⏷ Show the Full List of 12 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of FYVE and coiled-coil domain-containing protein 1 (FYCO1). [16]
------------------------------------------------------------------------------------

References

1 Mutations in FYCO1 cause autosomal-recessive congenital cataracts. Am J Hum Genet. 2011 Jun 10;88(6):827-838. doi: 10.1016/j.ajhg.2011.05.008.
2 FYCO1 mediates clearance of -synuclein aggregates through a Rab7-dependent mechanism.J Neurochem. 2018 Aug;146(4):474-492. doi: 10.1111/jnc.14461. Epub 2018 Jul 23.
3 FYCO1 regulates accumulation of post-mitotic midbodies by mediating LC3-dependent midbody degradation.J Cell Sci. 2017 Dec 1;130(23):4051-4062. doi: 10.1242/jcs.208983.
4 Proteomics of rimmed vacuoles define new risk allele in inclusion body myositis.Ann Neurol. 2017 Feb;81(2):227-239. doi: 10.1002/ana.24847. Epub 2017 Jan 27.
5 Genetic Study on Small Insertions and Deletions in Psoriasis Reveals a Role in Complex Human Diseases.J Invest Dermatol. 2019 Nov;139(11):2302-2312.e14. doi: 10.1016/j.jid.2019.03.1157. Epub 2019 May 10.
6 Phenotypes of Recessive Pediatric Cataract in a Cohort of Children with Identified Homozygous Gene Mutations (An American Ophthalmological Society Thesis). Trans Am Ophthalmol Soc. 2015;113:T7.
7 New Developments in the Genetics of Inclusion Body Myositis.Curr Rheumatol Rep. 2018 Apr 2;20(5):26. doi: 10.1007/s11926-018-0738-0.
8 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
9 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
10 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
11 Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
12 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
13 Proteomics-based identification of differentially abundant proteins from human keratinocytes exposed to arsenic trioxide. J Proteomics Bioinform. 2014 Jul;7(7):166-178.
14 Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
15 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
16 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
17 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
18 Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
19 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
20 Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.