Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTL2A8O8)

• DOT Name: Protein FAM124B (FAM124B)
• Gene Name: FAM124B
• Related Disease:
  Breast cancer
  CHARGE syndrome
  Neurodevelopmental disorder
• UniProt ID: F124B_HUMAN
• Pfam ID: PF15067
• Sequence:
  MDETQGPLAMTVHLLANSGHGSLLQRTLDQLLDCICPEVRLFQVSERASPVKYCEKSHSK
  RSRFPGMSVLLFLHESPGEDRLFRVLDSLQHSPWQCYPTQDTRGRLCPYFFANQEFYSLD
  SQLPIWGVRQVHCGSEILRVTLYCSFDNYEDAIRLYEMILQREATLQKSNFCFFVLYASK
  SFALQLSLKQLPPGMSVDPKESSVLQFKVQEIGQLVPLLPNPCMPISSTRWQTQDYDGNK
  ILLQVQLNPELGVKNGILGAGMLPLGSRLTSVSAKRTSEPRSQRNQGKRSQGHSLELPEP
  SGSPTSDRCAGTSWKSPGRSFQVSSPAMGAHLHLSSHHLESGARMKVLNRENSFQKLEAE
  TNVDTGLTIINSEPRQTYFGGFPRDLQTSQPPFCLPASSLGVATSKNNSVLKERVSPLPL
  AGQRDLGTRKTISECLLHLQVQGEEKEEDEEEFFI

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Breast cancer	DIS7DPX1	Strong	Altered Expression	[1]
CHARGE syndrome	DISKD3CW	moderate	Biomarker	[2]
Neurodevelopmental disorder	DIS372XH	moderate	Biomarker	[2]

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Protein FAM124B (FAM124B).	[3]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Protein FAM124B (FAM124B).	[4]

References

• [1] Estrogen and progesterone receptor status affect genome-wide DNA methylation profile in breast cancer.Hum Mol Genet. 2010 Nov 1;19(21):4273-7. doi: 10.1093/hmg/ddq351. Epub 2010 Aug 19.
• [2] Identification and characterization of FAM124B as a novel component of a CHD7 and CHD8 containing complex.PLoS One. 2012;7(12):e52640. doi: 10.1371/journal.pone.0052640. Epub 2012 Dec 21.
• [3] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [4] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.