Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTL6XBFA)

DOT Name	Syntaphilin (SNPH)
Gene Name	SNPH
Related Disease	Advanced cancer ( ) Alzheimer disease ( ) Amyotrophic lateral sclerosis ( ) Neoplasm ( ) Metastatic malignant neoplasm ( ) Prostate cancer ( ) Prostate carcinoma ( )
UniProt ID	SNPH_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF15290
Sequence	MAMSLPGSRRTSAGSRRRTSPPVSVRDAYGTSSLSSSSNSGSYKGSDSSPTPRRSMKYTL CSDNHGIKPPTPEQYLTPLQQKEVCIRHLKARLKDTQDRLQDRDTEIDDLKTQLSRMQED WIEEECHRVEAQLALKEARKEIKQLKQVIDTVKNNLIDKDKGLQKYFVDINIQNKKLETL LHSMEVAQNGMAKEDGTGESAGGSPARSLTRSSTYTKLSDPAVCGDRQPGDPSSGSAEDG ADSGFAAADDTLSRTDALEASSLLSSGVDCGTEETSLHSSFGLGPRFPASNTYEKLLCGM EAGVQASCMQERAIQTDFVQYQPDLDTILEKVTQAQVCGTDPESGDRCPELDAHPSGPRD PNSAVVVTVGDELEAPEPITRGPTPQRPGANPNPGQSVSVVCPMEEEEEAAVAEKEPKSY WSRHYIVDLLAVVVPAVPTVAWLCRSQRRQGQPIYNISSLLRGCCTVALHSIRRISCRSL SQPSPSPAGGGSQL
Function	Inhibits SNARE complex formation by absorbing free STX1A.
Tissue Specificity	Brain specific. Found in synapses.

Molecular Interaction Atlas (MIA) of This DOT

7 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Advanced cancer	DISAT1Z9	Strong	Biomarker	[1]
Alzheimer disease	DISF8S70	moderate	Biomarker	[2]
Amyotrophic lateral sclerosis	DISF7HVM	moderate	Altered Expression	[2]
Neoplasm	DISZKGEW	Disputed	Biomarker	[3]
Metastatic malignant neoplasm	DIS86UK6	Limited	Altered Expression	[4]
Prostate cancer	DISF190Y	Limited	Biomarker	[4]
Prostate carcinoma	DISMJPLE	Limited	Biomarker	[4]
------------------------------------------------------------------------------------


⏷ Show the Full List of 7 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Syntaphilin (SNPH).	[5]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Syntaphilin (SNPH).	[6]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Syntaphilin (SNPH).	[7]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Syntaphilin (SNPH).	[8]
OTX-015	DMI8RG1	Phase 1/2	OTX-015 increases the expression of Syntaphilin (SNPH).	[9]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Syntaphilin (SNPH).	[11]
------------------------------------------------------------------------------------


⏷ Show the Full List of 6 Drug(s)

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Syntaphilin (SNPH).	[10]
------------------------------------------------------------------------------------

References

1	Syntaphilin controls a mitochondrial rheostat for proliferation-motility decisions in cancer.J Clin Invest. 2017 Oct 2;127(10):3755-3769. doi: 10.1172/JCI93172. Epub 2017 Sep 11.
2	Removing dysfunctional mitochondria from axons independent of mitophagy under pathophysiological conditions.Autophagy. 2017 Oct 3;13(10):1792-1794. doi: 10.1080/15548627.2017.1356552. Epub 2017 Aug 16.
3	Syntaphilin Ubiquitination Regulates Mitochondrial Dynamics and Tumor Cell Movements.Cancer Res. 2018 Aug 1;78(15):4215-4228. doi: 10.1158/0008-5472.CAN-18-0595. Epub 2018 Jun 13.
4	Syntaphilin Is a Novel Biphasic Biomarker of Aggressive Prostate Cancer and a Metastasis Predictor.Am J Pathol. 2019 Jun;189(6):1180-1189. doi: 10.1016/j.ajpath.2019.02.009. Epub 2019 May 9.
5	Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
6	Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
7	Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
8	Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
9	Comprehensive transcriptome profiling of BET inhibitor-treated HepG2 cells. PLoS One. 2022 Apr 29;17(4):e0266966. doi: 10.1371/journal.pone.0266966. eCollection 2022.
10	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
11	Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.