General Information of Drug Off-Target (DOT) (ID: OTLJTZ0E)

DOT Name Sodium/potassium/calcium exchanger 4 (SLC24A4)
Synonyms Na(+)/K(+)/Ca(2+)-exchange protein 4; Solute carrier family 24 member 4
Gene Name SLC24A4
Related Disease
Amelogenesis imperfecta hypomaturation type 2A5 ( )
Amelogenesis imperfecta type 2 ( )
Amelogenesis imperfecta, type 3A ( )
UniProt ID
NCKX4_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF01699
Sequence
MALRGTLRPLKVRRRREMLPQQVGFVCAVLALVCCASGLFGSLGHKTASASKRVLPDTWR
NRKLMAPVNGTQTAKNCTDPAIHEFPTDLFSNKERQHGAVLLHILGALYMFYALAIVCDD
FFVPSLEKICERLHLSEDVAGATFMAAGSSTPELFASVIGVFITHGDVGVGTIVGSAVFN
ILCIIGVCGLFAGQVVRLTWWAVCRDSVYYTISVIVLIVFIYDEQIVWWEGLVLIILYVF
YILIMKYNVKMQAFFTVKQKSIANGNPVNSELEAGNDFYDGSYDDPSVPLLGQVKEKPQY
GKNPVVMVDEIMSSSPPKFTFPEAGLRIMITNKFGPRTRLRMASRIIINERQRLINSANG
VSSKPLQNGRHENIENGNVPVENPEDPQQNQEQQPPPQPPPPEPEPVEADFLSPFSVPEA
RGDKVKWVFTWPLIFLLCVTIPNCSKPRWEKFFMVTFITATLWIAVFSYIMVWLVTIIGY
TLGIPDVIMGITFLAAGTSVPDCMASLIVARQGLGDMAVSNTIGSNVFDILVGLGVPWGL
QTMVVNYGSTVKINSRGLVYSVVLLLGSVALTVLGIHLNKWRLDRKLGVYVLVLYAIFLC
FSIMIEFNVFTFVNLPMCREDD
Function
Calcium, potassium:sodium antiporter that transports 1 Ca(2+) and 1 K(+) in exchange for 4 Na(+). Controls the rapid response termination and proper regulation of adaptation in olfactory sensory neurons (OSNs) which subsequently influences how odor information is encoded and perceived. May play a role in calcium transport during amelogenesis.
Tissue Specificity Expressed abundantly in all regions of the brain, aorta, lung and thymus . Expressed at lower levels in the stomach and intestine .
KEGG Pathway
Olfactory transduction (hsa04740 )
Reactome Pathway
Defective SLC24A4 causes hypomineralized amelogenesis imperfecta (AI) (R-HSA-5619055 )
Sodium/Calcium exchangers (R-HSA-425561 )

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Amelogenesis imperfecta hypomaturation type 2A5 DIS1554S Strong Autosomal recessive [1]
Amelogenesis imperfecta type 2 DISX8NN4 Supportive Autosomal recessive [2]
Amelogenesis imperfecta, type 3A DISP3OJG Supportive Autosomal dominant [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin increases the expression of Sodium/potassium/calcium exchanger 4 (SLC24A4). [3]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the mutagenesis of Sodium/potassium/calcium exchanger 4 (SLC24A4). [5]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Sodium/potassium/calcium exchanger 4 (SLC24A4). [6]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of Sodium/potassium/calcium exchanger 4 (SLC24A4). [4]
------------------------------------------------------------------------------------

References

1 Identification of mutations in SLC24A4, encoding a potassium-dependent sodium/calcium exchanger, as a cause of amelogenesis imperfecta. Am J Hum Genet. 2013 Feb 7;92(2):307-12. doi: 10.1016/j.ajhg.2013.01.003. Epub 2013 Jan 31.
2 STIM1 and SLC24A4 Are Critical for Enamel Maturation. J Dent Res. 2014 Jul;93(7 Suppl):94S-100S. doi: 10.1177/0022034514527971. Epub 2014 Mar 12.
3 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
4 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
5 Exome-wide mutation profile in benzo[a]pyrene-derived post-stasis and immortal human mammary epithelial cells. Mutat Res Genet Toxicol Environ Mutagen. 2014 Dec;775-776:48-54. doi: 10.1016/j.mrgentox.2014.10.011. Epub 2014 Nov 4.
6 Comparison of transcriptome expression alterations by chronic exposure to low-dose bisphenol A in different subtypes of breast cancer cells. Toxicol Appl Pharmacol. 2019 Dec 15;385:114814. doi: 10.1016/j.taap.2019.114814. Epub 2019 Nov 9.