Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTLKYGW4)

DOT Name	Nuclear receptor-interacting protein 2 (NRIP2)
Gene Name	NRIP2
Related Disease	Colorectal carcinoma ( )
UniProt ID	NRIP2_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF09668
Sequence	MLFIFPLSLPWRPSCWKESCSTGQRQAGRSREDSVTPPPSSPWPTPPAGAMSTKQEARRD EGEARTRGQEAQLRDRAHLSQQRRLKQATQFLHKDSADLLPLDSLKRLGTSKDLQPRSVI QRRLVEGNPNWLQGEPPRMQDLIHGQESRRKTSRTEIPALLVNCKCQDQLLRVAVDTGTQ YNRISAGCLSRLGLEKRVLKASAGDLAPGPPTQVEQLELQLGQETVVCSAQVVDAESPEF CLGLQTLLSLKCCIDLEHGVLRLKAPFSELPFLPLYQEPGQ
Function	Down-regulates transcriptional activation by nuclear receptors such as NR1F2.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance		REF
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Nuclear receptor-interacting protein 2 (NRIP2).	[2]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Nuclear receptor-interacting protein 2 (NRIP2).	[3]
------------------------------------------------------------------------------------

References

1	Up-regulated NRIP2 in colorectal cancer initiating cells modulates the Wnt pathway by targeting ROR.Mol Cancer. 2017 Jan 31;16(1):20. doi: 10.1186/s12943-017-0590-2.
2	Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
3	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.