Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OTLLM5JY)
| DOT Name | Binder of sperm protein homolog 1 (BSPH1) | ||||
|---|---|---|---|---|---|
| Synonyms | Bovine seminal plasma protein homolog 1; Bovine seminal plasma protein-like 1 | ||||
| Gene Name | BSPH1 | ||||
| Related Disease | |||||
| UniProt ID | |||||
| 3D Structure | |||||
| Pfam ID | |||||
| Sequence | 
                                         
                        MGSLMLLFVETTRNSSACIFPVILNELSSTVETITHFPEVTDGECVFPFHYKNGTYYDCI 
                    
                KSKARHKWCSLNKTYEGYWKFCSAEDFANCVFPFWYRRLIYWECTDDGEAFGKKWCSLTK NFNKDRIWKYCE  | 
            ||||
| Function | 
                                         
                        Binds sperm in vitro and promotes sperm capacitation. Specifically promotes capacitation induced by high density lipoproteins (HDLs). Also binds heparin, phospholipid liposomes, and weakly to gelatin. Does not bind chondroitin sulfate B.
                        
                     
                                     | 
            ||||
| Tissue Specificity | Expressed only in the epididymis. | ||||
Molecular Interaction Atlas (MIA) of This DOT
| 
                     3 Disease(s) Related to This DOT 
                                                
  | 
            ||||||||||||||||||||||||||||||||||||
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 
                     2 Drug(s) Affected the Post-Translational Modifications of This DOT 
                                                
  | 
            ||||||||||||||||||||||||||||||||||||
| 
                     1 Drug(s) Affected the Gene/Protein Processing of This DOT 
                                                
  | 
            ||||||||||||||||||||||||||||||||||||
References
