Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTLOCZZI)

DOT Name	Protein FAM151B (FAM151B)
Gene Name	FAM151B
UniProt ID	F151B_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF10223
Sequence	MAASAGGPGSWSENILEYFLRNSQITAEDGAEITWYHAANHKAQTNEALKSTAHMIEADV LLPSDGSEHSQPIMAHPPETNSDNTLQEWLTEVMKSNKGIKLDFKSLAVVEPSMMLLENV KRHLKRPVWINADILPGPNGNSKVIDAKPFLDTVISFFPDVTFSLGWTTGWHPEKVNEGY SWTMVKEMEYICNELSQPVTFPVRAALVRQSCSQLLWLLKKSNRYSLTIWTGKNDNYSVE DLLYIRDHFDKKQVFYDILEPQNHEFKQAIGIKVNL
Function	Essential for survival of retinal photoreceptor cells.

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Estradiol	DMUNTE3	Approved	Estradiol affects the expression of Protein FAM151B (FAM151B).	[1]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Protein FAM151B (FAM151B).	[2]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Protein FAM151B (FAM151B).	[3]
------------------------------------------------------------------------------------

References

1	Identification of novel low-dose bisphenol a targets in human foreskin fibroblast cells derived from hypospadias patients. PLoS One. 2012;7(5):e36711. doi: 10.1371/journal.pone.0036711. Epub 2012 May 4.
2	Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
3	Bisphenol A and bisphenol S induce distinct transcriptional profiles in differentiating human primary preadipocytes. PLoS One. 2016 Sep 29;11(9):e0163318.