Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OTLZD0FO)
| DOT Name | UL-16 binding protein 5 (RAET1G) | ||||
|---|---|---|---|---|---|
| Synonyms | Retinoic acid early transcript 1G protein | ||||
| Gene Name | RAET1G | ||||
| Related Disease | |||||
| UniProt ID | |||||
| 3D Structure | |||||
| Pfam ID | |||||
| Sequence |
MAAAASPAFLLRLPLLLLLSSWCRTGLADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKT
FLHYDCGSKTVTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLLDIQLENYIPKEPLT LQARMSCEQKAEGHGSGSWQLSFDGQIFLLFDSENRMWTTVHPGARKMKEKWENDKDMTM SFHYISMGDCTGWLEDFLMGMDSTLEPSAGAPPTMSSGTAQPRATATTLILCCLLIMCLL ICSRHSLTQSHGHHPQSLQPPPHPPLLHPTWLLRRVLWSDSYQIAKRPLSGGHVTRVTLP IIGDDSHSLPCPLALYTINNGAARYSEPLQVSIS |
||||
| Function |
[Isoform 1]: Binds and activates the KLRK1/NKG2D receptor, mediating natural killer cell cytotoxicity; [Isoform 3]: Down-regulates the expression of KLRK1 and stimulates natural killer cells to secrete IFNG; [Isoform 2]: Stimulates natural killer cells to secrete IFNG.
|
||||
| Tissue Specificity |
Isoform 1 is highly expressed in colon and in a number of tumor cell lines and highly restricted in normal tissues. Both isoforms are frequently expressed in cell lines derived from epithelial cancers, and in primary breast cancers.
|
||||
| KEGG Pathway | |||||
| Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DOT
|
1 Disease(s) Related to This DOT
|
||||||||||||||||||||||||||
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
1 Drug(s) Affected the Post-Translational Modifications of This DOT
|
||||||||||||||||||||||||||
References
