| DOT Name |
DNA-directed RNA polymerase II subunit RPB11-a (POLR2J)
|
| Synonyms |
RNA polymerase II subunit B11-a; RPB11a; DNA-directed RNA polymerase II subunit J-1; RNA polymerase II 13.3 kDa subunit |
| Gene Name |
POLR2J
|
| Related Disease |
- Breast carcinoma ( )
|
| UniProt ID |
|
| 3D Structure |
|
| PDB ID |
5IY6 ; 5IY7 ; 5IY8 ; 5IY9 ; 5IYA ; 5IYB ; 5IYC ; 5IYD ; 6DRD ; 6O9L ; 6XRE ; 7LBM
|
| Pfam ID |
|
| Sequence |
MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAG YKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE
|
| Function |
Core component of RNA polymerase II (Pol II), a DNA-dependent RNA polymerase which synthesizes mRNA precursors and many functional non-coding RNAs using the four ribonucleoside triphosphates as substrates.
|
| Tissue Specificity |
Ubiquitously expressed. High expression was found in heart and skeletal muscle. |
| KEGG Pathway |
- R. polymerase (hsa03020 )
- Nucleotide excision repair (hsa03420 )
- Huntington disease (hsa05016 )
|
| Reactome Pathway |
- Formation of the Early Elongation Complex (R-HSA-113418 )
- Formation of HIV elongation complex in the absence of HIV Tat (R-HSA-167152 )
- Formation of the HIV-1 Early Elongation Complex (R-HSA-167158 )
- RNA Pol II CTD phosphorylation and interaction with CE during HIV infection (R-HSA-167160 )
- HIV Transcription Initiation (R-HSA-167161 )
- RNA Polymerase II HIV Promoter Escape (R-HSA-167162 )
- Transcription of the HIV genome (R-HSA-167172 )
- Formation of HIV-1 elongation complex containing HIV-1 Tat (R-HSA-167200 )
- Pausing and recovery of Tat-mediated HIV elongation (R-HSA-167238 )
- Abortive elongation of HIV-1 transcript in the absence of Tat (R-HSA-167242 )
- Tat-mediated HIV elongation arrest and recovery (R-HSA-167243 )
- Tat-mediated elongation of the HIV-1 transcript (R-HSA-167246 )
- HIV elongation arrest and recovery (R-HSA-167287 )
- Pausing and recovery of HIV elongation (R-HSA-167290 )
- Viral Messenger RNA Synthesis (R-HSA-168325 )
- MicroRNA (miRNA) biogenesis (R-HSA-203927 )
- Transcriptional regulation by small RNAs (R-HSA-5578749 )
- PIWI-interacting RNA (piRNA) biogenesis (R-HSA-5601884 )
- Activation of anterior HOX genes in hindbrain development during early embryogenesis (R-HSA-5617472 )
- RNA Polymerase II Pre-transcription Events (R-HSA-674695 )
- Formation of TC-NER Pre-Incision Complex (R-HSA-6781823 )
- Transcription-Coupled Nucleotide Excision Repair (TC-NER) (R-HSA-6781827 )
- Dual incision in TC-NER (R-HSA-6782135 )
- Gap-filling DNA repair synthesis and ligation in TC-NER (R-HSA-6782210 )
- TP53 Regulates Transcription of DNA Repair Genes (R-HSA-6796648 )
- FGFR2 alternative splicing (R-HSA-6803529 )
- RNA polymerase II transcribes snRNA genes (R-HSA-6807505 )
- mRNA Capping (R-HSA-72086 )
- mRNA Splicing - Major Pathway (R-HSA-72163 )
- mRNA Splicing - Minor Pathway (R-HSA-72165 )
- Processing of Capped Intron-Containing Pre-mRNA (R-HSA-72203 )
- RNA Polymerase II Promoter Escape (R-HSA-73776 )
- RNA Polymerase II Transcription Pre-Initiation And Promoter Opening (R-HSA-73779 )
- RNA Polymerase II Transcription Initiation (R-HSA-75953 )
- RNA Polymerase II Transcription Elongation (R-HSA-75955 )
- RNA Polymerase II Transcription Initiation And Promoter Clearance (R-HSA-76042 )
- RNA Pol II CTD phosphorylation and interaction with CE (R-HSA-77075 )
- Signaling by FGFR2 IIIa TM (R-HSA-8851708 )
- Estrogen-dependent gene expression (R-HSA-9018519 )
- Inhibition of DNA recombination at telomere (R-HSA-9670095 )
- Formation of RNA Pol II elongation complex (R-HSA-112382 )
|
|
|
|
|
|
|